(data stored in ACNUC1104 zone)

EMBL: CP002026.PE229

CP002026.PE229       Location/Qualifiers
FT   CDS             219546..220268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_12307 short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87566"
FT                   /db_xref="GOA:D7A1V0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87566.1"
FT                   /translation="MTRLDGKTAVVTGAGRGIGRATALALAQAGAHVVAVARTQADLDQ
FT                   LAREGEGRIEPLAADVRDEDFLARIEAMGDLDILVNNAGGNRPKMMVDVDDETLDWMID
FT                   LNIRSVYRVARAAARAMGEGGVIVNMSSQMGHVGSPRRTVYCMTKHAVEGLTKAMAVEL
FT                   APRGIRVVSIAPTFVVTPMTQGMFEDAEFKRFVYDMVPMNDLPVPEDIAQSILFLVSPG
FT                   ARFITGDSLRVDGGWTAR"
     MTRLDGKTAV VTGAGRGIGR ATALALAQAG AHVVAVARTQ ADLDQLAREG EGRIEPLAAD        60
     VRDEDFLARI EAMGDLDILV NNAGGNRPKM MVDVDDETLD WMIDLNIRSV YRVARAAARA       120
     MGEGGVIVNM SSQMGHVGSP RRTVYCMTKH AVEGLTKAMA VELAPRGIRV VSIAPTFVVT       180
     PMTQGMFEDA EFKRFVYDMV PMNDLPVPED IAQSILFLVS PGARFITGDS LRVDGGWTAR       240
//

If you have problems or comments...

PBIL Back to PBIL home page