(data stored in ACNUC1104 zone)

EMBL: CP002026.PE231

CP002026.PE231       Location/Qualifiers
FT   CDS             221747..224110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0232"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bbt:BBta_5376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87568"
FT                   /db_xref="GOA:D7A1V2"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH87568.1"
FT                   /translation="MSLLDRKLLRDISTMRGQVVTISLVIAAGIAVFVASISTYDSLLS
FT                   ARDRFYLNARFPQVFVTLKRAPLSLLSQINEIAGIVTAEPRIVRELIVDSPASVLPISA
FT                   RMVSIQNGGDESLVRLHMRRGTAPLPGDAKSVAINEAYADASGIVPGDDIRILLNGRVQ
FT                   TFRISGTALSAEYVYSVKPGLPIPDDRLYATIWVDRSAVEAAFDLKGAFNDLVVFVAPG
FT                   TDPQAVIAELDRLLEPYGSVGAIERRDQPSNRFLDDELNQQRVMSITIPFIFFGVAAFL
FT                   LNVVLGRLVAAQREQIAALKALGFSAVPIGMHYIKLVAVIVLIGSLLGIACSVAFGEAM
FT                   IAAYRGFFRLPVFTFELTPWSLVAGTAVSFAMASLGVLSAVRNVLVLPPAVAMRPVAPL
FT                   RFRRLRLEGLMTAFGYTPQRMMIVRNLAGRPVRTALTVIGIAFAVPMVVLGLFWRDAID
FT                   HMIDVQFNLVERGNVAVTFPHPFDRGIIYDLARQPGVLAAEGQRIVPVRLRASQRSYLT
FT                   SVIGLPTGSELRRPHDASLRPIDVSAEGITLTRRLAERLDVDLGQVVTIEVMEGRRLRR
FT                   DLPVGAIVDELIGMASYMQMDAINQLTGEGDVVSAAALFVDPAALSDLLRRFKDLPVIE
FT                   SVAVKSYTLSSFMAKIAGLVFVSAGILTAFGIIIAVGVVYNSARIGLQERAWELASLRV
FT                   LGFSGAEVSRILFSEFAFEIALGVPLGLLTSRAIISLIAQFHSNESFQIPGVIGPRTYA
FT                   AAGLVVVLAALASAYVVRRQIDRLDLVAALKTRD"
     MSLLDRKLLR DISTMRGQVV TISLVIAAGI AVFVASISTY DSLLSARDRF YLNARFPQVF        60
     VTLKRAPLSL LSQINEIAGI VTAEPRIVRE LIVDSPASVL PISARMVSIQ NGGDESLVRL       120
     HMRRGTAPLP GDAKSVAINE AYADASGIVP GDDIRILLNG RVQTFRISGT ALSAEYVYSV       180
     KPGLPIPDDR LYATIWVDRS AVEAAFDLKG AFNDLVVFVA PGTDPQAVIA ELDRLLEPYG       240
     SVGAIERRDQ PSNRFLDDEL NQQRVMSITI PFIFFGVAAF LLNVVLGRLV AAQREQIAAL       300
     KALGFSAVPI GMHYIKLVAV IVLIGSLLGI ACSVAFGEAM IAAYRGFFRL PVFTFELTPW       360
     SLVAGTAVSF AMASLGVLSA VRNVLVLPPA VAMRPVAPLR FRRLRLEGLM TAFGYTPQRM       420
     MIVRNLAGRP VRTALTVIGI AFAVPMVVLG LFWRDAIDHM IDVQFNLVER GNVAVTFPHP       480
     FDRGIIYDLA RQPGVLAAEG QRIVPVRLRA SQRSYLTSVI GLPTGSELRR PHDASLRPID       540
     VSAEGITLTR RLAERLDVDL GQVVTIEVME GRRLRRDLPV GAIVDELIGM ASYMQMDAIN       600
     QLTGEGDVVS AAALFVDPAA LSDLLRRFKD LPVIESVAVK SYTLSSFMAK IAGLVFVSAG       660
     ILTAFGIIIA VGVVYNSARI GLQERAWELA SLRVLGFSGA EVSRILFSEF AFEIALGVPL       720
     GLLTSRAIIS LIAQFHSNES FQIPGVIGPR TYAAAGLVVV LAALASAYVV RRQIDRLDLV       780
     AALKTRD                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page