(data stored in ACNUC1104 zone)

EMBL: CP002026.PE232

CP002026.PE232       Location/Qualifiers
FT   CDS             224113..225312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0233"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bbt:BBta_3438 putative secretion protein
FT                   HlyD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87569"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87569.1"
FT                   /translation="MRITVGRGIGLLLLLIAVAGVVWAVLPRPIPVETSKVTKGHFVAT
FT                   VDDDGNTRIRERYVVAAPLAGRLTRVQLKAGDRASTGDVLASILPSPAPFLDPRSRRES
FT                   QERLGAAEAALERAKAMVERARAQAVQAEQELTRTRTLVERGASTMQALERAELAKRVA
FT                   DRDLRAAAFQLHAAEHELDQARALLAQYSDGAKEIPETWSVTAPITGIVLKVNQESETI
FT                   VQPGTPLLELGDPRDIEIVVDVLSTDAVEIRPGARVTIEHWGGPNALEGRVRRVEPAAF
FT                   TKISTLGVEEQRVNVLIDIVSPPDRWSGLGEAYQVDAKIAVFGLEDATIVPAGALFRRD
FT                   DTWHVFTVENGRAQLTPVVVLRRSARSAAIGSGLVLGQSVIVYPSDRIEAGVSVKTSSK
FT                   "
     MRITVGRGIG LLLLLIAVAG VVWAVLPRPI PVETSKVTKG HFVATVDDDG NTRIRERYVV        60
     AAPLAGRLTR VQLKAGDRAS TGDVLASILP SPAPFLDPRS RRESQERLGA AEAALERAKA       120
     MVERARAQAV QAEQELTRTR TLVERGASTM QALERAELAK RVADRDLRAA AFQLHAAEHE       180
     LDQARALLAQ YSDGAKEIPE TWSVTAPITG IVLKVNQESE TIVQPGTPLL ELGDPRDIEI       240
     VVDVLSTDAV EIRPGARVTI EHWGGPNALE GRVRRVEPAA FTKISTLGVE EQRVNVLIDI       300
     VSPPDRWSGL GEAYQVDAKI AVFGLEDATI VPAGALFRRD DTWHVFTVEN GRAQLTPVVV       360
     LRRSARSAAI GSGLVLGQSV IVYPSDRIEA GVSVKTSSK                              399
//

If you have problems or comments...

PBIL Back to PBIL home page