(data stored in ACNUC1104 zone)

EMBL: CP002026.PE236

CP002026.PE236       Location/Qualifiers
FT   CDS             227078..228031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0237"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: mrd:Mrad2831_5925 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87573"
FT                   /db_xref="GOA:D7A1V7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADH87573.1"
FT                   /translation="MTARMIMKLDVAERVDDATDVILVSLRHPRRPALPAWKAGAHIDV
FT                   HLPDGRIRQYSLCGDPADRTRYRIAVKREMAGRGGSAWIHETLAVGDAVHCSAPRNNFA
FT                   LAPQAGRHLFIAGGIGVTPLAALAYEALQRGDAFELHLRARSRRHAPLLAELERAFAGH
FT                   LHLHLDDEAPASLDDILAWFGVTADAHLYFCGPAGLNAAIAAAAERQSWAAERCHTEVF
FT                   QPTLDENFKPEPFDITIASTGQTLRVPADRSALDILRANGFVMPSSCELGVCGACICGY
FT                   RDGTVIHRDSVLSLADRQDKLTPCVSRARVGVTLEL"
     MTARMIMKLD VAERVDDATD VILVSLRHPR RPALPAWKAG AHIDVHLPDG RIRQYSLCGD        60
     PADRTRYRIA VKREMAGRGG SAWIHETLAV GDAVHCSAPR NNFALAPQAG RHLFIAGGIG       120
     VTPLAALAYE ALQRGDAFEL HLRARSRRHA PLLAELERAF AGHLHLHLDD EAPASLDDIL       180
     AWFGVTADAH LYFCGPAGLN AAIAAAAERQ SWAAERCHTE VFQPTLDENF KPEPFDITIA       240
     STGQTLRVPA DRSALDILRA NGFVMPSSCE LGVCGACICG YRDGTVIHRD SVLSLADRQD       300
     KLTPCVSRAR VGVTLEL                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page