(data stored in ACNUC1104 zone)

EMBL: CP002026.PE238

CP002026.PE238       Location/Qualifiers
FT   CDS             230297..231139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0240"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: xau:Xaut_4128 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87575"
FT                   /db_xref="GOA:D7A1V9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V9"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADH87575.1"
FT                   /translation="MTTTDAPAPARASVFSADEVERYARHLVLAEIGGPGQQKLKKASM
FT                   LVVGAGGLGAPALLYLAAAGVGRLVVIDDDIVSLSNLQRQVIHTTERIGQPKTESAGAL
FT                   VAALNPHVVFEGVDARITADNAMELVSSVDVVIDGSDNFSTRYLVSDACALAGRPLVTA
FT                   ALGRFDATVTTLRPHEKNADGTPNPTYRCLFPEPPPAGTVPTCAEAGILGALAGVAGSL
FT                   VALEAVRAVVGFGEGLVGRLLMIDTMSMRFETLSYGWDPDNPLTGESPTITDLSAHRR"
     MTTTDAPAPA RASVFSADEV ERYARHLVLA EIGGPGQQKL KKASMLVVGA GGLGAPALLY        60
     LAAAGVGRLV VIDDDIVSLS NLQRQVIHTT ERIGQPKTES AGALVAALNP HVVFEGVDAR       120
     ITADNAMELV SSVDVVIDGS DNFSTRYLVS DACALAGRPL VTAALGRFDA TVTTLRPHEK       180
     NADGTPNPTY RCLFPEPPPA GTVPTCAEAG ILGALAGVAG SLVALEAVRA VVGFGEGLVG       240
     RLLMIDTMSM RFETLSYGWD PDNPLTGESP TITDLSAHRR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page