(data stored in ACNUC1104 zone)

EMBL: CP002026.PE24

CP002026.PE24        Location/Qualifiers
FT   CDS             16398..18404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0024"
FT                   /product="phage tape measure protein"
FT                   /note="TIGRFAM: phage tape measure protein; KEGG:
FT                   avi:Avi_0873 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87361"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU7"
FT                   /inference="protein motif:TFAM:TIGR02675"
FT                   /protein_id="ADH87361.1"
FT                   /translation="MATDIEKLVVQMSADIKGFERELRKAQGIGERRATAIERRFQQMN
FT                   KRISASLGSSVSLGGLAGAVGLGISIADFVETTKRIDSLRQSLKAITGSEAEAAREMQF
FT                   VTETAEKLGLELLSTGEAYASLMAATKDTTLEGEATRDIFVAVANAMSTLGKSSADTEA
FT                   ALLAVQQMVSKGKVSAEELRGQLGERLPGAFKAAADALGITTAELDEMLQKGQVTAEVL
FT                   LPRLAKRLEELYSVDRKSTLTAEINRLNNAVTDLYRTLADTGAIGLVTSALKDLANIIK
FT                   EIAAYSQLVGQGRFGEAFAVDPAGAARMKLRLGQGTALTDDQSAAWDQAFGMTGSAPST
FT                   VTVNKPAPPAFAPAAEKQRLDSYQRLTAAIKERTGAIEAETAAQASLNPLMNDYGFAVE
FT                   KARAEYDLLTAAQEAGLSITPELRAQIDTLATAYANASAASEQLRESQGRLQQAAADFN
FT                   EMGRGVLSGFIADFTNAETRADALNNAIGRIVDSLAEMALSSVFKPQGSGSGGLFGAFF
FT                   SALTGGTSGTTSGYAGASALYDEGGYTGDGGKHDVAGAVHRGEYVFSKAAVQRLGADNL
FT                   EMLHLMGKKGYADGGFVGGLSMPRISRRGGASRGAGAVLSFSPVTNIDATGSQVSRQEI
FT                   AGMLAQRDKALMAGVQRAMPGWIVSARKRNVGI"
     MATDIEKLVV QMSADIKGFE RELRKAQGIG ERRATAIERR FQQMNKRISA SLGSSVSLGG        60
     LAGAVGLGIS IADFVETTKR IDSLRQSLKA ITGSEAEAAR EMQFVTETAE KLGLELLSTG       120
     EAYASLMAAT KDTTLEGEAT RDIFVAVANA MSTLGKSSAD TEAALLAVQQ MVSKGKVSAE       180
     ELRGQLGERL PGAFKAAADA LGITTAELDE MLQKGQVTAE VLLPRLAKRL EELYSVDRKS       240
     TLTAEINRLN NAVTDLYRTL ADTGAIGLVT SALKDLANII KEIAAYSQLV GQGRFGEAFA       300
     VDPAGAARMK LRLGQGTALT DDQSAAWDQA FGMTGSAPST VTVNKPAPPA FAPAAEKQRL       360
     DSYQRLTAAI KERTGAIEAE TAAQASLNPL MNDYGFAVEK ARAEYDLLTA AQEAGLSITP       420
     ELRAQIDTLA TAYANASAAS EQLRESQGRL QQAAADFNEM GRGVLSGFIA DFTNAETRAD       480
     ALNNAIGRIV DSLAEMALSS VFKPQGSGSG GLFGAFFSAL TGGTSGTTSG YAGASALYDE       540
     GGYTGDGGKH DVAGAVHRGE YVFSKAAVQR LGADNLEMLH LMGKKGYADG GFVGGLSMPR       600
     ISRRGGASRG AGAVLSFSPV TNIDATGSQV SRQEIAGMLA QRDKALMAGV QRAMPGWIVS       660
     ARKRNVGI                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page