(data stored in ACNUC1104 zone)

EMBL: CP002026.PE241

CP002026.PE241       Location/Qualifiers
FT   CDS             complement(233052..233462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0243"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bja:bll5259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87578"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W2"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADH87578.1"
FT                   /translation="MPMIQIKFSSPSPTPRMEAALAGRAAQLAEEWLGKDPAVTAVLVE
FT                   RADPSCWFCGGRSLAEARLAAFWLDIRVTEGTNTKDEKAAFVAACFEAFAALLGPLHAE
FT                   SYVHVVEARGDAYGYGGVTQERRYIAARPAAA"
     MPMIQIKFSS PSPTPRMEAA LAGRAAQLAE EWLGKDPAVT AVLVERADPS CWFCGGRSLA        60
     EARLAAFWLD IRVTEGTNTK DEKAAFVAAC FEAFAALLGP LHAESYVHVV EARGDAYGYG       120
     GVTQERRYIA ARPAAA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page