(data stored in ACNUC1104 zone)

EMBL: CP002026.PE246

CP002026.PE246       Location/Qualifiers
FT   CDS             237304..238155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0248"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   xau:Xaut_0052 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87583"
FT                   /db_xref="GOA:D7A1W7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87583.1"
FT                   /translation="MGLMQGNLMNGKRGLIMGVANDHSIAWGIAKTLAAQGAELAFTYQ
FT                   GEALGRRVRPLAESLGSDTLISCDVEDLDSVDAVFAALKEKWGSIDFLVHAIGFSDKNE
FT                   LKGRYADTTRANFTRTMVISCFSFTELAKRAAAIMPNGGSVITLTYGGSTRVMPNYNVM
FT                   GVAKAALEASVRYLAADYGPQGIRVNAISAGPIRTLAGAGIADARLMFNYQKRNAPLRR
FT                   TVTIDEVGGSALYLLSDLSSGVTGEVHFVDSGYNIISMPHPDALKTIEDAEERAAGEVA
FT                   AE"
     MGLMQGNLMN GKRGLIMGVA NDHSIAWGIA KTLAAQGAEL AFTYQGEALG RRVRPLAESL        60
     GSDTLISCDV EDLDSVDAVF AALKEKWGSI DFLVHAIGFS DKNELKGRYA DTTRANFTRT       120
     MVISCFSFTE LAKRAAAIMP NGGSVITLTY GGSTRVMPNY NVMGVAKAAL EASVRYLAAD       180
     YGPQGIRVNA ISAGPIRTLA GAGIADARLM FNYQKRNAPL RRTVTIDEVG GSALYLLSDL       240
     SSGVTGEVHF VDSGYNIISM PHPDALKTIE DAEERAAGEV AAE                         283
//

If you have problems or comments...

PBIL Back to PBIL home page