(data stored in ACNUC1104 zone)

EMBL: CP002026.PE249

CP002026.PE249       Location/Qualifiers
FT   CDS             complement(241370..242125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0251"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; KEGG: azc:AZC_0137
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase; PFAM:
FT                   acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87586"
FT                   /db_xref="GOA:D7A1X0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X0"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ADH87586.1"
FT                   /translation="MSSQDTLILIPARMASTRLPGKPLADLGGRPMIVEVARRSAAANI
FT                   GRVVVATDDEGVRKAVENAGFAVVMTRADHTTGSDRIFEALGHVDPERRVSRIVNVQGD
FT                   LPTIDPALIRSAVDLLDDPAVDIGTLAAQITVEAERTNPNVVKAVGSPLSPSRLRALYF
FT                   TRATAPYGEGPLFHHIGLYAYRRAALERFVALPPSPLESREKLEQLRALEAGMRIDVAI
FT                   VDTVPLGVDTPEDLERARELLAREAKTAK"
     MSSQDTLILI PARMASTRLP GKPLADLGGR PMIVEVARRS AAANIGRVVV ATDDEGVRKA        60
     VENAGFAVVM TRADHTTGSD RIFEALGHVD PERRVSRIVN VQGDLPTIDP ALIRSAVDLL       120
     DDPAVDIGTL AAQITVEAER TNPNVVKAVG SPLSPSRLRA LYFTRATAPY GEGPLFHHIG       180
     LYAYRRAALE RFVALPPSPL ESREKLEQLR ALEAGMRIDV AIVDTVPLGV DTPEDLERAR       240
     ELLAREAKTA K                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page