(data stored in ACNUC1104 zone)

EMBL: CP002026.PE250

CP002026.PE250       Location/Qualifiers
FT   CDS             242343..242984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0252"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: azc:AZC_0136
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87587"
FT                   /db_xref="GOA:D7A1X1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X1"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADH87587.1"
FT                   /translation="MDGFELNKIAGAVLGVLTFTVGLNVFSDILFTTHAPEKPGFEIAV
FT                   QEASSGSAQAAAPADVPIAQLLATASVEKGAAQAKKCAACHNFQEGAGAKVGPDLYAVV
FT                   GRAVASAPGFAYSAAMKAHGGEWTFEQLNNFIKNPKADIPGTAMGFAGIAKESERADLL
FT                   VYLNTLSHNPLPLPKPEEAAPAAAPAAAPAGEKPAEPAPAAPAPAAPAHP"
     MDGFELNKIA GAVLGVLTFT VGLNVFSDIL FTTHAPEKPG FEIAVQEASS GSAQAAAPAD        60
     VPIAQLLATA SVEKGAAQAK KCAACHNFQE GAGAKVGPDL YAVVGRAVAS APGFAYSAAM       120
     KAHGGEWTFE QLNNFIKNPK ADIPGTAMGF AGIAKESERA DLLVYLNTLS HNPLPLPKPE       180
     EAAPAAAPAA APAGEKPAEP APAAPAPAAP AHP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page