(data stored in ACNUC1104 zone)

EMBL: CP002026.PE253

CP002026.PE253       Location/Qualifiers
FT   CDS             247380..248486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0255"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_0133 peptide ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87590"
FT                   /db_xref="GOA:D7A1X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87590.1"
FT                   /translation="MLAYIVRRLALMVPTVIGIMLISFAVVQFAPGGPVEKVIAELTGQ
FT                   GASATSRITGGGGDFGGMQQNAPAGDPVSSKYRGAQGLDPAFIKQLEKQFGFDKPAYER
FT                   FGKMLWDYARFDFGRSYFRDISVIDLIAEKMPVSISLGLWMTLITYAISIPLGIAKAVR
FT                   DGSRFDVWTSAVIIVGYAIPSFLFAILLIILFAGGSFFSWFPLRGLTSDNWDQLSLGAK
FT                   ILDYFWHLALPITSMVLGAFATMALLTKNSFLDEIRKQYVITARMKGLSERAVLYRHVF
FT                   RNAMLIIIAGFPGAFVAAFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFANLYIFS
FT                   LVGLLINLLSDLTYTWVDPRIDFETRDV"
     MLAYIVRRLA LMVPTVIGIM LISFAVVQFA PGGPVEKVIA ELTGQGASAT SRITGGGGDF        60
     GGMQQNAPAG DPVSSKYRGA QGLDPAFIKQ LEKQFGFDKP AYERFGKMLW DYARFDFGRS       120
     YFRDISVIDL IAEKMPVSIS LGLWMTLITY AISIPLGIAK AVRDGSRFDV WTSAVIIVGY       180
     AIPSFLFAIL LIILFAGGSF FSWFPLRGLT SDNWDQLSLG AKILDYFWHL ALPITSMVLG       240
     AFATMALLTK NSFLDEIRKQ YVITARMKGL SERAVLYRHV FRNAMLIIIA GFPGAFVAAF       300
     FSGSLLIETI FSLDGLGLLG FESVLNRDYP VVFANLYIFS LVGLLINLLS DLTYTWVDPR       360
     IDFETRDV                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page