(data stored in ACNUC1104 zone)

EMBL: CP002026.PE255

CP002026.PE255       Location/Qualifiers
FT   CDS             249701..249961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87592"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X6"
FT                   /inference="similar to AA sequence:KEGG:RPE_3763"
FT                   /protein_id="ADH87592.1"
FT                   /translation="MNKIVREHYPVDRLPEDLREGIEGPYVSVTVVTEEAPAGVDERIE
FT                   AILRNPKPMTIEEARARVGERGTTTEEAVARIRALRDEWDE"
     MNKIVREHYP VDRLPEDLRE GIEGPYVSVT VVTEEAPAGV DERIEAILRN PKPMTIEEAR        60
     ARVGERGTTT EEAVARIRAL RDEWDE                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page