(data stored in ACNUC1104 zone)

EMBL: CP002026.PE259

CP002026.PE259       Location/Qualifiers
FT   CDS             complement(253753..254103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0262"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: oan:Oant_0731 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87596"
FT                   /db_xref="GOA:D7A1Y0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH87596.1"
FT                   /translation="MAVELRPSQALRLLHELSLAQVRDDAPDLSPRQLAILLGVYLEAP
FT                   PHTVRGLAARLGVTKPVITRALDTMGELGLVSRRRDDADRRNVIIQRTVEGALYVERLG
FT                   DLVVTVARSLPR"
     MAVELRPSQA LRLLHELSLA QVRDDAPDLS PRQLAILLGV YLEAPPHTVR GLAARLGVTK        60
     PVITRALDTM GELGLVSRRR DDADRRNVII QRTVEGALYV ERLGDLVVTV ARSLPR           116
//

If you have problems or comments...

PBIL Back to PBIL home page