(data stored in ACNUC1104 zone)

EMBL: CP002026.PE260

CP002026.PE260       Location/Qualifiers
FT   CDS             complement(254373..255749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0263"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: azc:AZC_0280 leucine aminopeptidase; PFAM:
FT                   peptidase M17 leucyl aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87597"
FT                   /db_xref="GOA:D7A1Y1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y1"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ADH87597.1"
FT                   /translation="MGAQLIRAEEASQPRPIWCVTPQNWREVAGGLPVPALSFAEATGF
FT                   KAEAGALLILPAADGSIAGAIFGCEEVPRDPLAFGKLATALPAGDYRIAHAPADPRLAA
FT                   LGFLLGGYRFTRYGKRNGADVRLVVPEGVDAAYVLRTAEAVALTRDLVNTPANDLGPAE
FT                   IEAAVRALASRFGAEVRVTTGEDLLAENFPLIHAVGRASPRAPRLIDMSWGDPNARKVT
FT                   LVGKGVAFDTGGLDIKPSSGMLLMKKDMGGAANAIGLAQMIMGRGLNVRLRLIIPAVEN
FT                   AIDGSAFRPGDIFPSRKGLTVEIGNTDAEGRLILADALSLADEEAPELLIDFATLTGAA
FT                   RVALGPQLPPAYTDDEALAADLARFGAAEADPSWRLPLWQPYASMLDSKIADLNNAPGG
FT                   GFAGSITAALFLQRFVERAGAWLHLDIFAWNPSPRPGRPEGGEAQTIRALDALIAERFG
FT                   "
     MGAQLIRAEE ASQPRPIWCV TPQNWREVAG GLPVPALSFA EATGFKAEAG ALLILPAADG        60
     SIAGAIFGCE EVPRDPLAFG KLATALPAGD YRIAHAPADP RLAALGFLLG GYRFTRYGKR       120
     NGADVRLVVP EGVDAAYVLR TAEAVALTRD LVNTPANDLG PAEIEAAVRA LASRFGAEVR       180
     VTTGEDLLAE NFPLIHAVGR ASPRAPRLID MSWGDPNARK VTLVGKGVAF DTGGLDIKPS       240
     SGMLLMKKDM GGAANAIGLA QMIMGRGLNV RLRLIIPAVE NAIDGSAFRP GDIFPSRKGL       300
     TVEIGNTDAE GRLILADALS LADEEAPELL IDFATLTGAA RVALGPQLPP AYTDDEALAA       360
     DLARFGAAEA DPSWRLPLWQ PYASMLDSKI ADLNNAPGGG FAGSITAALF LQRFVERAGA       420
     WLHLDIFAWN PSPRPGRPEG GEAQTIRALD ALIAERFG                               458
//

If you have problems or comments...

PBIL Back to PBIL home page