(data stored in ACNUC1104 zone)

EMBL: CP002026.PE261

CP002026.PE261       Location/Qualifiers
FT   CDS             complement(255884..256474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0264"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: xau:Xaut_4141
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87598"
FT                   /db_xref="GOA:D7A1Y2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADH87598.1"
FT                   /translation="MIKRRIFLVRHGETDWNLAGRLQGYHDIPLNDLGREQAAETARVV
FT                   ERLSGGTVGLDYVASPLSRASQTMAILRAELGLPPDGFRRDPRLREIGFGRWEGATWPE
FT                   LRRRDPVNLAARDADPWNFVPPGGESYADLSARVLAAIGELTHDAVVVTHGGVVRAILH
FT                   ALTGMPAAQAVELPVRQGAVYLIEDGAFELAVA"
     MIKRRIFLVR HGETDWNLAG RLQGYHDIPL NDLGREQAAE TARVVERLSG GTVGLDYVAS        60
     PLSRASQTMA ILRAELGLPP DGFRRDPRLR EIGFGRWEGA TWPELRRRDP VNLAARDADP       120
     WNFVPPGGES YADLSARVLA AIGELTHDAV VVTHGGVVRA ILHALTGMPA AQAVELPVRQ       180
     GAVYLIEDGA FELAVA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page