(data stored in ACNUC1104 zone)

EMBL: CP002026.PE264

CP002026.PE264       Location/Qualifiers
FT   CDS             complement(258057..259028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0267"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: azc:AZC_1199 heat shock protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87601"
FT                   /db_xref="GOA:D7A1Y5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y5"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADH87601.1"
FT                   /translation="MRDPYDILGVARNADQNEIKRAFRKHAKKLHPDANKDDPKAQERF
FT                   AELNSAHEILSDPEKRGQYDRGEIDAEGKPRGFEGFPGGGAGGFNRGGFQRGPHGETIF
FT                   ESFSFGPEGARRSGHGPHDAGGFDDVIADILGGLGGRGRGRARAGGQQEMPRGGDVDIS
FT                   VPVPLERVVEGGPVKVHLPNGRTVEVKIPPKVTEGHRMRLKGQGEPSPFGGAPGDAYVV
FT                   VAYAPHRHFKVEGADLRTDVSLPLADAVLGGKLRVPTLSGEVELSVPAWTQSGRTFRLR
FT                   GKGLPKGDDAAGDLFATVRITLPETPDAELEELMRRRRDGAA"
     MRDPYDILGV ARNADQNEIK RAFRKHAKKL HPDANKDDPK AQERFAELNS AHEILSDPEK        60
     RGQYDRGEID AEGKPRGFEG FPGGGAGGFN RGGFQRGPHG ETIFESFSFG PEGARRSGHG       120
     PHDAGGFDDV IADILGGLGG RGRGRARAGG QQEMPRGGDV DISVPVPLER VVEGGPVKVH       180
     LPNGRTVEVK IPPKVTEGHR MRLKGQGEPS PFGGAPGDAY VVVAYAPHRH FKVEGADLRT       240
     DVSLPLADAV LGGKLRVPTL SGEVELSVPA WTQSGRTFRL RGKGLPKGDD AAGDLFATVR       300
     ITLPETPDAE LEELMRRRRD GAA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page