(data stored in ACNUC1104 zone)

EMBL: CP002026.PE266

CP002026.PE266       Location/Qualifiers
FT   CDS             259664..260290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0269"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   azc:AZC_1197 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87603"
FT                   /db_xref="GOA:D7A1Y7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y7"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADH87603.1"
FT                   /translation="MEASEELISGDFTAATEPFRLFEEWFAEAKEKEPRDPNAMALATV
FT                   DADGLPDVRMVLLNQRDERGFVFFTNTGSAKGCELAAVPKAAVVFHWKSMNRQIRVRGP
FT                   VEVVSDEEADAYFLTRPRLSQIGAWASVQSRPLEGRFALEAAVAKYTAQYALGSVPRPP
FT                   HWTGFRIRPVQIEFWHDRPFRLHDRIVFRRDSAEATVWNKTRLYP"
     MEASEELISG DFTAATEPFR LFEEWFAEAK EKEPRDPNAM ALATVDADGL PDVRMVLLNQ        60
     RDERGFVFFT NTGSAKGCEL AAVPKAAVVF HWKSMNRQIR VRGPVEVVSD EEADAYFLTR       120
     PRLSQIGAWA SVQSRPLEGR FALEAAVAKY TAQYALGSVP RPPHWTGFRI RPVQIEFWHD       180
     RPFRLHDRIV FRRDSAEATV WNKTRLYP                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page