(data stored in ACNUC1104 zone)

EMBL: CP002026.PE267

CP002026.PE267       Location/Qualifiers
FT   CDS             260340..261089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0270"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_1067 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87604"
FT                   /db_xref="GOA:D7A1Y8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87604.1"
FT                   /translation="MTKGTNQPRRTMLLTGASRGIGHATVKRFSAAGWRVITCSRHAFP
FT                   ENCPWEMGPEDHIQVDLSDPADTLRAVDEIKSRLPDGELHALVNNAGISPKGPGGSRLG
FT                   TLNTPEEDWRRVFQVNFFAPILLARGLLEELKRTHGAVVNVTSIAGSRVHPFAGAAYAT
FT                   SKAALAGLTREMAADFGPLGVRVNAIAPGEIDTSILSPGTEKIVEQIPMQRLGTPDEVA
FT                   KIIYVLCTDTSSYLNGAEIHINGGQHV"
     MTKGTNQPRR TMLLTGASRG IGHATVKRFS AAGWRVITCS RHAFPENCPW EMGPEDHIQV        60
     DLSDPADTLR AVDEIKSRLP DGELHALVNN AGISPKGPGG SRLGTLNTPE EDWRRVFQVN       120
     FFAPILLARG LLEELKRTHG AVVNVTSIAG SRVHPFAGAA YATSKAALAG LTREMAADFG       180
     PLGVRVNAIA PGEIDTSILS PGTEKIVEQI PMQRLGTPDE VAKIIYVLCT DTSSYLNGAE       240
     IHINGGQHV                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page