(data stored in ACNUC1104 zone)

EMBL: CP002026.PE268

CP002026.PE268       Location/Qualifiers
FT   CDS             complement(261299..262276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0271"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: oca:OCAR_6914 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87605"
FT                   /db_xref="GOA:D7A1Y9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y9"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADH87605.1"
FT                   /translation="MITAHCVRGGTLVSVHLGAGEALPPDAVWIDLNQPADGEDRLVEA
FT                   AIGISVPTRAEMLEIEPSSRLRVENGARYMTGSIVCNSDSDRPTLAQVSFILAKGKLTT
FT                   VRYDEPKPFRLVLAKLDRDCPQTMKGDRLLLELLDTIVDRAADIIETLSEDIDGLSRRI
FT                   FERESSSNGGSQRFRVILKLLGRRADLASKVRESLVSMGRLVTFLSTEGEAERFDKEQR
FT                   TWLKSMQRDTASLNDHVSYLGNKIIFLLDATLGMVSIEQNNIIKIFAVLSVVLMPPTLI
FT                   ASIYGMNFQHMPELGERFGYPVALIAMLAAAVVPYWFFKWKKWL"
     MITAHCVRGG TLVSVHLGAG EALPPDAVWI DLNQPADGED RLVEAAIGIS VPTRAEMLEI        60
     EPSSRLRVEN GARYMTGSIV CNSDSDRPTL AQVSFILAKG KLTTVRYDEP KPFRLVLAKL       120
     DRDCPQTMKG DRLLLELLDT IVDRAADIIE TLSEDIDGLS RRIFERESSS NGGSQRFRVI       180
     LKLLGRRADL ASKVRESLVS MGRLVTFLST EGEAERFDKE QRTWLKSMQR DTASLNDHVS       240
     YLGNKIIFLL DATLGMVSIE QNNIIKIFAV LSVVLMPPTL IASIYGMNFQ HMPELGERFG       300
     YPVALIAMLA AAVVPYWFFK WKKWL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page