(data stored in ACNUC1104 zone)

EMBL: CP002026.PE271

CP002026.PE271       Location/Qualifiers
FT   CDS             complement(263787..265169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0274"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mno:Mnod_5513 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87608"
FT                   /db_xref="GOA:D7A1Z2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z2"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADH87608.1"
FT                   /translation="MLTNLQARDVETLVHPYTNLVAVRETGPLILERGKGVWVHDVDGK
FT                   PYLEGMAGLWCTALGYGNEELVEAAATQMRKLPFTHIFGGKSHDPAIELAEKLKEMAPV
FT                   PISKVFFTCSGSEANDTQMKLVWYMNNALGRPKKKKIISRMRAYHGVTIAAASLTGLAG
FT                   NHNDFDLPIAGVRHTTCPHYYRLAEAGESEEDFATRLAADLEALIIAEGPETVAAFIAE
FT                   PVLGAGGVIVPPKTYYPKIQAVLEKYDVFFIADEVITGFGRLGTAFGCEAMEMKPHSIS
FT                   VAKALSSAYQPIGGVMIPEDMYQAMLEESRKLGSFGHGYTYSAHPVAAAVAVKTLEIYE
FT                   RESIFERVRAKIPHFGARRAALEDHPLVGEARGAGLVAGIELVADKKSKHQFDPKLGVA
FT                   AKCVAFAQEEGLIVRNVFGDAVTICPPLVISPAEIDELFDRLTRALDKTLDWAVRENLL
FT                   AA"
     MLTNLQARDV ETLVHPYTNL VAVRETGPLI LERGKGVWVH DVDGKPYLEG MAGLWCTALG        60
     YGNEELVEAA ATQMRKLPFT HIFGGKSHDP AIELAEKLKE MAPVPISKVF FTCSGSEAND       120
     TQMKLVWYMN NALGRPKKKK IISRMRAYHG VTIAAASLTG LAGNHNDFDL PIAGVRHTTC       180
     PHYYRLAEAG ESEEDFATRL AADLEALIIA EGPETVAAFI AEPVLGAGGV IVPPKTYYPK       240
     IQAVLEKYDV FFIADEVITG FGRLGTAFGC EAMEMKPHSI SVAKALSSAY QPIGGVMIPE       300
     DMYQAMLEES RKLGSFGHGY TYSAHPVAAA VAVKTLEIYE RESIFERVRA KIPHFGARRA       360
     ALEDHPLVGE ARGAGLVAGI ELVADKKSKH QFDPKLGVAA KCVAFAQEEG LIVRNVFGDA       420
     VTICPPLVIS PAEIDELFDR LTRALDKTLD WAVRENLLAA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page