(data stored in ACNUC1104 zone)

EMBL: CP002026.PE272

CP002026.PE272       Location/Qualifiers
FT   CDS             complement(265258..266610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0275"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: xau:Xaut_2474
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87609"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z3"
FT                   /inference="protein motif:PFAM:PF06904"
FT                   /protein_id="ADH87609.1"
FT                   /translation="MDFRSLPFIRLPFPRRVAPILAVGLLLAGASPLAADDLTRSIDRA
FT                   GNAINRQLGDFFGVTPERPAKRRPATKSTATAKPVDGKVPLPPSRPGEADQQAALTSQP
FT                   EEASAPKPEAKPAVAEPDMPKPDIKAASDPGEAKPDTPTPSGERAATSDPGEAKPDTPA
FT                   PSGEREVVVPPPAAPEPPAAASAPLPPPAPERLAALPPPAAGPTAEPAETARAAPVPTI
FT                   CPELSNEDIGVFTPTEVKTTEPACTLDRGVVLSAVRMKDGRLVQLQPAAELRCEMAASV
FT                   ARWLREKVEPAVATLGSPLDKVLVAGSLQCRSRNHVAGAKISEHGRGNALDTHGYELKD
FT                   GRRFVIGPPSMGSGEHAMPVDFQEKLKASACADFTTILGPGSDGYHEQHLHVDRAERRS
FT                   GAVLCQWATARVEAVPPKPPVKPAEAKAGEPAASDAPPEEGATPDSAGKSQ"
     MDFRSLPFIR LPFPRRVAPI LAVGLLLAGA SPLAADDLTR SIDRAGNAIN RQLGDFFGVT        60
     PERPAKRRPA TKSTATAKPV DGKVPLPPSR PGEADQQAAL TSQPEEASAP KPEAKPAVAE       120
     PDMPKPDIKA ASDPGEAKPD TPTPSGERAA TSDPGEAKPD TPAPSGEREV VVPPPAAPEP       180
     PAAASAPLPP PAPERLAALP PPAAGPTAEP AETARAAPVP TICPELSNED IGVFTPTEVK       240
     TTEPACTLDR GVVLSAVRMK DGRLVQLQPA AELRCEMAAS VARWLREKVE PAVATLGSPL       300
     DKVLVAGSLQ CRSRNHVAGA KISEHGRGNA LDTHGYELKD GRRFVIGPPS MGSGEHAMPV       360
     DFQEKLKASA CADFTTILGP GSDGYHEQHL HVDRAERRSG AVLCQWATAR VEAVPPKPPV       420
     KPAEAKAGEP AASDAPPEEG ATPDSAGKSQ                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page