(data stored in ACNUC1104 zone)

EMBL: CP002026.PE274

CP002026.PE274       Location/Qualifiers
FT   CDS             267392..268177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0277"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   azc:AZC_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87611"
FT                   /db_xref="GOA:D7A1Z5"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z5"
FT                   /inference="protein motif:PFAM:PF07386"
FT                   /protein_id="ADH87611.1"
FT                   /translation="MIRRRLYIEERMSRLAVWSLRTAIFAFPVTLIGAALYATETLDFR
FT                   SAAYTVLAGVGVAVLALLLAFAGFVVIWNEGLKGLGRVIGAAALALLLITPTATLAALA
FT                   VGLKTLPDVTSDTEDPPEFVTLGTVRSRASTGLAYPGGKLADDQLDIYPGIKPITFDAP
FT                   PDEIFRVLMNMVTRHKWLVVDSVPPRGERDGRIEAVARSLPFGLRDDMVIRVRRTPTGS
FT                   IVDMRSVARSGNRDFGSNARRIDQLFDELADQQGRPRRQ"
     MIRRRLYIEE RMSRLAVWSL RTAIFAFPVT LIGAALYATE TLDFRSAAYT VLAGVGVAVL        60
     ALLLAFAGFV VIWNEGLKGL GRVIGAAALA LLLITPTATL AALAVGLKTL PDVTSDTEDP       120
     PEFVTLGTVR SRASTGLAYP GGKLADDQLD IYPGIKPITF DAPPDEIFRV LMNMVTRHKW       180
     LVVDSVPPRG ERDGRIEAVA RSLPFGLRDD MVIRVRRTPT GSIVDMRSVA RSGNRDFGSN       240
     ARRIDQLFDE LADQQGRPRR Q                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page