(data stored in ACNUC1104 zone)

EMBL: CP002026.PE278

CP002026.PE278       Location/Qualifiers
FT   CDS             complement(270592..271512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87615"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z9"
FT                   /inference="similar to AA sequence:KEGG:RC1_2166"
FT                   /protein_id="ADH87615.1"
FT                   /translation="MAVRVSTLLPATAFLPLPVPLAVSGQPRRVGVEVEFTRLSERRAA
FT                   ERIAREMGGTLREEDPHAFHIIGSRLGDLCVELDMRHAHPHRDGHPMPRLRPHAGLIGA
FT                   ALRPFVPRELVTGPILPGDLGEMDDLVRALREEGAGGDGATVLGSLGLHFNIVPASLEP
FT                   SALLAMLRAFLLSEPRLRAQGLTGLSRLHAPPPYPQDYVDKVLGPGYRPDLEALCDDYV
FT                   GANPTRSRALDLLPLFLELFPERVAPRISGKVKPRAALHYRLPVARVGRPGWSLAEDWN
FT                   RWVEVERLAADPSRLAAAVARHRPV"
     MAVRVSTLLP ATAFLPLPVP LAVSGQPRRV GVEVEFTRLS ERRAAERIAR EMGGTLREED        60
     PHAFHIIGSR LGDLCVELDM RHAHPHRDGH PMPRLRPHAG LIGAALRPFV PRELVTGPIL       120
     PGDLGEMDDL VRALREEGAG GDGATVLGSL GLHFNIVPAS LEPSALLAML RAFLLSEPRL       180
     RAQGLTGLSR LHAPPPYPQD YVDKVLGPGY RPDLEALCDD YVGANPTRSR ALDLLPLFLE       240
     LFPERVAPRI SGKVKPRAAL HYRLPVARVG RPGWSLAEDW NRWVEVERLA ADPSRLAAAV       300
     ARHRPV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page