(data stored in ACNUC1104 zone)

EMBL: CP002026.PE28

CP002026.PE28        Location/Qualifiers
FT   CDS             20105..22708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87365"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87365.1"
FT                   /translation="MPFIAPIIGAVGAAIGAVGSFVGSLGIVGQALLGIGASVLSSVIQ
FT                   KETAGKAEKQPGGVQFERQYGGDVPRQVACGLVGIAGHDTYVNTFGPANGILQQIYTLS
FT                   DFPCHGLSRVAINGKWVTLGPVGEDGMRKVTSGEYADLIRVQFVDGTQTAALAGLVNSA
FT                   NPSDRWTANHIGAGVAYVYIALAFTEPLTNFPDFFFEFYGARFYDWRKDSTVGGSGGHR
FT                   WGNYATYEFTENPVVIEYNYRRGIAWNGDMFCGMAMPAADLPLAKWTAAANICDETTDY
FT                   GTRYRCSIMLDCTAMHGENITSLQLSCGAKKVDAVDGSWPLVGHDQAVVATITDDDLIV
FT                   GVRGRWTARRSMSDLVNRVYGTFPNPDNLWSPADYELQGGGALVVLDRRDRDVPLDFPM
FT                   VRVPGQAAQLARIYLEENRYEATGDEVWRPRFQVLEPGDWIRRIGRTHGDRIYQITGLS
FT                   LASHDADGPRNVSVSLQEVDGAIYDGITAPPIVVPMPPGAPVLLNEVQDFDLAPVTVLG
FT                   DDGRLLPAIRASWASITDVTVAYVDLQYWPTAQPTSVFTKRVPATETITVLAEGVVRAT
FT                   EYTVRTRLVTQPPRVTVWSAGETVTTTAIPDTEIDVYLANIKGDAYDALRRMREDLTAN
FT                   VQRMDMFVRDTSVGLGRQVTSTSVATRLGKANATAIQSVQSSVQDLGDQVLAMAEIIDA
FT                   VNASIESINGTLAGQASAMTALTARVTASEGGINALAASTTTLSATVGDLSASGLLRIE
FT                   ARAGSGDVSARLVVLMRATTGSVWREVGTIWETGFTGGNPALPFARIANYADQFVIISP
FT                   IDDGRLPPFVVDTGLGQVIITEALIKRLMVNNFTLTGAGSKLLITSNPARIRATS"
     MPFIAPIIGA VGAAIGAVGS FVGSLGIVGQ ALLGIGASVL SSVIQKETAG KAEKQPGGVQ        60
     FERQYGGDVP RQVACGLVGI AGHDTYVNTF GPANGILQQI YTLSDFPCHG LSRVAINGKW       120
     VTLGPVGEDG MRKVTSGEYA DLIRVQFVDG TQTAALAGLV NSANPSDRWT ANHIGAGVAY       180
     VYIALAFTEP LTNFPDFFFE FYGARFYDWR KDSTVGGSGG HRWGNYATYE FTENPVVIEY       240
     NYRRGIAWNG DMFCGMAMPA ADLPLAKWTA AANICDETTD YGTRYRCSIM LDCTAMHGEN       300
     ITSLQLSCGA KKVDAVDGSW PLVGHDQAVV ATITDDDLIV GVRGRWTARR SMSDLVNRVY       360
     GTFPNPDNLW SPADYELQGG GALVVLDRRD RDVPLDFPMV RVPGQAAQLA RIYLEENRYE       420
     ATGDEVWRPR FQVLEPGDWI RRIGRTHGDR IYQITGLSLA SHDADGPRNV SVSLQEVDGA       480
     IYDGITAPPI VVPMPPGAPV LLNEVQDFDL APVTVLGDDG RLLPAIRASW ASITDVTVAY       540
     VDLQYWPTAQ PTSVFTKRVP ATETITVLAE GVVRATEYTV RTRLVTQPPR VTVWSAGETV       600
     TTTAIPDTEI DVYLANIKGD AYDALRRMRE DLTANVQRMD MFVRDTSVGL GRQVTSTSVA       660
     TRLGKANATA IQSVQSSVQD LGDQVLAMAE IIDAVNASIE SINGTLAGQA SAMTALTARV       720
     TASEGGINAL AASTTTLSAT VGDLSASGLL RIEARAGSGD VSARLVVLMR ATTGSVWREV       780
     GTIWETGFTG GNPALPFARI ANYADQFVII SPIDDGRLPP FVVDTGLGQV IITEALIKRL       840
     MVNNFTLTGA GSKLLITSNP ARIRATS                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page