(data stored in ACNUC1104 zone)

EMBL: CP002026.PE281

CP002026.PE281       Location/Qualifiers
FT   CDS             complement(273367..274101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbr:BB1775 putative ATP-binding component of
FT                   ABC transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87618"
FT                   /db_xref="GOA:D7A202"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A202"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87618.1"
FT                   /translation="MNPPADTPMLEVDGLEAWYGEAKILFGLSLTVAPGEAVALVGRNG
FT                   AGKSTTMKAVMGLVRRRARRLALHGQDIAALPTYAIARLGIGYVPEDRRIFTDLTVTEN
FT                   LDLGRRAVRPGGGSLMGPDWPREALFELFPNLAALRDRLGGQMSGGEQQMLAVARALVG
FT                   RPALLLLDEPSEGIAPIIVEQMINALGALKASGLSLLISEQNTALCSAVCNRAYVIEQG
FT                   ELRWQGAMSDLDSAVEPMRIFG"
     MNPPADTPML EVDGLEAWYG EAKILFGLSL TVAPGEAVAL VGRNGAGKST TMKAVMGLVR        60
     RRARRLALHG QDIAALPTYA IARLGIGYVP EDRRIFTDLT VTENLDLGRR AVRPGGGSLM       120
     GPDWPREALF ELFPNLAALR DRLGGQMSGG EQQMLAVARA LVGRPALLLL DEPSEGIAPI       180
     IVEQMINALG ALKASGLSLL ISEQNTALCS AVCNRAYVIE QGELRWQGAM SDLDSAVEPM       240
     RIFG                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page