(data stored in ACNUC1104 zone)

EMBL: CP002026.PE283

CP002026.PE283       Location/Qualifiers
FT   CDS             complement(274868..276766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0286"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB1773
FT                   putative permease component of branched-chain amino acid
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87620"
FT                   /db_xref="GOA:D7A204"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A204"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87620.1"
FT                   /translation="MSLDALLFQAVNGLASASGLFLVAAGLSIIFGVTRIVNMAHGSFY
FT                   MLGLYLAVTLAPKLGTWIGGPLGFWAGILAAALVVAALGALIEMTLLRRLYGAPELYQL
FT                   LATFALLLVINDAALFLWGPEDILGPRAPGLSGSVMLLGRRLPQYDIFLALIGPAVLIG
FT                   LHLLLARTRFGRLIRAATQDREMVAALGINEALLFTAVFALGAGIAGLGGALQMAREPA
FT                   SLTLDLSVLGDAFVVVVVGGMGSIRGAYLAAVLVAEAKALCTALGVVDIFGFTFNMSRL
FT                   TLVAEFLVMALVLIVRPHGLFGRPQPPAARGGPAEPPLRPFSAPARVFALAAIALFAAM
FT                   PLIGTLVSYAPVLALDMLVAALFAASLHFIMGPGGMASFGHAAYFGLGAYGTAYAVTAL
FT                   DLPTPLAFATGIGVAAFGAVLFGWFCVRLEGVYFAMLTLAFAQIVWSVAFQWEEVTGGS
FT                   NGLFDVWPEWPFDSRTGLYLAAFVVTLAGLMLLRRLVFAPFGMALRAARDSRLRAEASG
FT                   IPVARVRWLAFALAGAVCGAAGGLFAFAKGSISPEAISVGRSIDGLVMVLIGGVQSLVG
FT                   PVVGAGAFTLLQDSVMRETDYWRALLGVLILAIVLLFPFGIAGGLSRGLRRPGGAR"
     MSLDALLFQA VNGLASASGL FLVAAGLSII FGVTRIVNMA HGSFYMLGLY LAVTLAPKLG        60
     TWIGGPLGFW AGILAAALVV AALGALIEMT LLRRLYGAPE LYQLLATFAL LLVINDAALF       120
     LWGPEDILGP RAPGLSGSVM LLGRRLPQYD IFLALIGPAV LIGLHLLLAR TRFGRLIRAA       180
     TQDREMVAAL GINEALLFTA VFALGAGIAG LGGALQMARE PASLTLDLSV LGDAFVVVVV       240
     GGMGSIRGAY LAAVLVAEAK ALCTALGVVD IFGFTFNMSR LTLVAEFLVM ALVLIVRPHG       300
     LFGRPQPPAA RGGPAEPPLR PFSAPARVFA LAAIALFAAM PLIGTLVSYA PVLALDMLVA       360
     ALFAASLHFI MGPGGMASFG HAAYFGLGAY GTAYAVTALD LPTPLAFATG IGVAAFGAVL       420
     FGWFCVRLEG VYFAMLTLAF AQIVWSVAFQ WEEVTGGSNG LFDVWPEWPF DSRTGLYLAA       480
     FVVTLAGLML LRRLVFAPFG MALRAARDSR LRAEASGIPV ARVRWLAFAL AGAVCGAAGG       540
     LFAFAKGSIS PEAISVGRSI DGLVMVLIGG VQSLVGPVVG AGAFTLLQDS VMRETDYWRA       600
     LLGVLILAIV LLFPFGIAGG LSRGLRRPGG AR                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page