(data stored in ACNUC1104 zone)

EMBL: CP002026.PE288

CP002026.PE288       Location/Qualifiers
FT   CDS             280676..281674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0291"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpb:RPB_1841 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87625"
FT                   /db_xref="GOA:D7A209"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A209"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87625.1"
FT                   /translation="MRGDSGLLSARQRAAVQAAAVAVALTALAAAGPAQAQSGVYGYQS
FT                   SYQLYSRSAASNPSAWRPGNAPVYPSGSVYQPPRPSADVGAARGVYGYAPPARRTTTAP
FT                   ASSYAASANPSGYDADVELPPAPVQAAAPTTRQTKAASRSTRGTATRTAAVPASYTVED
FT                   DIYDDPDTPLPLYRPSTGAKGVDRKFDRHVVRYSSSDPAGTIIVDTGARYLYLIQGDGT
FT                   AVRYGIGVGKEGFQWAGSERISRKAEWPEWRPPSEMLDRRPDLPRVMPGGEDNPLGARA
FT                   LYLGKSLYRIHGSNEPETIGQAVSSGCIRMRNEDVIDLYGRVQVGTLVRVI"
     MRGDSGLLSA RQRAAVQAAA VAVALTALAA AGPAQAQSGV YGYQSSYQLY SRSAASNPSA        60
     WRPGNAPVYP SGSVYQPPRP SADVGAARGV YGYAPPARRT TTAPASSYAA SANPSGYDAD       120
     VELPPAPVQA AAPTTRQTKA ASRSTRGTAT RTAAVPASYT VEDDIYDDPD TPLPLYRPST       180
     GAKGVDRKFD RHVVRYSSSD PAGTIIVDTG ARYLYLIQGD GTAVRYGIGV GKEGFQWAGS       240
     ERISRKAEWP EWRPPSEMLD RRPDLPRVMP GGEDNPLGAR ALYLGKSLYR IHGSNEPETI       300
     GQAVSSGCIR MRNEDVIDLY GRVQVGTLVR VI                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page