(data stored in ACNUC1104 zone)

EMBL: CP002026.PE289

CP002026.PE289       Location/Qualifiers
FT   CDS             282044..282832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0292"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: azc:AZC_3919 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87626"
FT                   /db_xref="GOA:D7A210"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A210"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADH87626.1"
FT                   /translation="MAADTRTDGTTSEAADTHFGFRTVPLGEKQRMVDEVFHSVARRYD
FT                   LMNDLMSLGLHRAWKDLLVSRLRPPKTDRSFRLLDVAGGTGDVSFRTVEAGGAGTSATV
FT                   ADINGGMLGVGRERAASLGLSDRVEFVEANAEELPFADKSFDATTIAFGIRNVPRMDKA
FT                   LAEMRRVLKPGGRCFVLEFSRVDVPGLDAIYDAYSFKLIPPMGKLVTGDAESYQYLVES
FT                   IRKFPSPEAFAEMMRAAGFSRVDVTPLTGGIVCLHSGVRI"
     MAADTRTDGT TSEAADTHFG FRTVPLGEKQ RMVDEVFHSV ARRYDLMNDL MSLGLHRAWK        60
     DLLVSRLRPP KTDRSFRLLD VAGGTGDVSF RTVEAGGAGT SATVADINGG MLGVGRERAA       120
     SLGLSDRVEF VEANAEELPF ADKSFDATTI AFGIRNVPRM DKALAEMRRV LKPGGRCFVL       180
     EFSRVDVPGL DAIYDAYSFK LIPPMGKLVT GDAESYQYLV ESIRKFPSPE AFAEMMRAAG       240
     FSRVDVTPLT GGIVCLHSGV RI                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page