(data stored in ACNUC1104 zone)

EMBL: CP002026.PE291

CP002026.PE291       Location/Qualifiers
FT   CDS             284700..284828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87628"
FT                   /db_xref="GOA:D7A212"
FT                   /db_xref="UniProtKB/TrEMBL:D7A212"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87628.1"
FT                   /translation="MTLLQWYILVGVPFILLAGAFAADRLSAYDSRHADRHTGPAE"
     MTLLQWYILV GVPFILLAGA FAADRLSAYD SRHADRHTGP AE                           42
//

If you have problems or comments...

PBIL Back to PBIL home page