(data stored in ACNUC1104 zone)

EMBL: CP002026.PE293

CP002026.PE293       Location/Qualifiers
FT   CDS             285080..286309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0296"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; KEGG:
FT                   azc:AZC_3913 DNA/pantothenate metabolism flavoprotein;
FT                   PFAM: flavoprotein; DNA/pantothenate metabolism
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87630"
FT                   /db_xref="GOA:D7A214"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7A214"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADH87630.1"
FT                   /translation="MLATKRILLIIGGGIAAYKSLDLIRRLKERGASVRVIMTAAAQHF
FT                   VTPLAAGALSHERVFTELFDREAEHDIGHIRLSREADLIIVAPATADLMAKMAHGLADD
FT                   LASAVLLASDKPVLVAPAMNPLMWSHAATRRNAAQLAADGVAFIGPNAGAMAERGEDGP
FT                   GRMAEPMEIVEAAERLLAASGPLKGRHVLVTSGPTHEPIDPVRYIANRSSGKQGHAIAA
FT                   AAARAGAQVTLVSGPVNLPDPAGVDVRHVESARDMLAAVEAALPADAAIFAAAVADWRA
FT                   ASEAGEKLKKDGNAIPPLMLTENPDILATVAHLSNRRPRLVVGFAAETQNVVAYAQAKR
FT                   ARKGCDWIVANDVSQHSGIAGGVMGGDSNAVHLITAEGVEHWPEASKAAVAEKLIARVA
FT                   ASLGPLGAAE"
     MLATKRILLI IGGGIAAYKS LDLIRRLKER GASVRVIMTA AAQHFVTPLA AGALSHERVF        60
     TELFDREAEH DIGHIRLSRE ADLIIVAPAT ADLMAKMAHG LADDLASAVL LASDKPVLVA       120
     PAMNPLMWSH AATRRNAAQL AADGVAFIGP NAGAMAERGE DGPGRMAEPM EIVEAAERLL       180
     AASGPLKGRH VLVTSGPTHE PIDPVRYIAN RSSGKQGHAI AAAAARAGAQ VTLVSGPVNL       240
     PDPAGVDVRH VESARDMLAA VEAALPADAA IFAAAVADWR AASEAGEKLK KDGNAIPPLM       300
     LTENPDILAT VAHLSNRRPR LVVGFAAETQ NVVAYAQAKR ARKGCDWIVA NDVSQHSGIA       360
     GGVMGGDSNA VHLITAEGVE HWPEASKAAV AEKLIARVAA SLGPLGAAE                   409
//

If you have problems or comments...

PBIL Back to PBIL home page