(data stored in ACNUC1104 zone)

EMBL: CP002026.PE297

CP002026.PE297       Location/Qualifiers
FT   CDS             288476..290995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0300"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: met:M446_0500 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87634"
FT                   /db_xref="GOA:D7A218"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A218"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87634.1"
FT                   /translation="MAHPAGMGGERNQGGRVPQVRPGRRLLRPLFTGLAFAAPIAPASA
FT                   APASDVFAVLAVQDPSVLIGLALVVGLIVFATTTAIVHLRYRRQSLRREMAAFGEISRL
FT                   EAQIDEARALLMAEPQIVVVWRDPAADPEIIGNTPAFTGVAAPARILAFGSWLTPASAR
FT                   EIEAAVDRLRGRGTPLAATLATQDGRFVEADGRPVGAAVVLRLRDITGVRLDQAQLEAA
FT                   YRALDAESSALRTLLDALPAPAWVDGEDGRLRWSNAAYAHAVEARDASDAASRGLMLLD
FT                   QQSRTQAEKAHAASLPFKARLPVVVAGTRRVLDVLEVPAGGGAAGIALDATEAEVVRAE
FT                   LAQVVGAHRRTLDQLATAVAIFGADQRLVFHNAAYARLFDLDAAFLDDRPTDGAVLDRL
FT                   RAARRLPEQADFRLWREELHAAYRAIEPREHWWHLPGGRTLRVVTAPNPEGGITYLFDE
FT                   VTERLALESRFNSLTRIQSETLDALAEAVAVFGSDGRLGLVNSAFRRLWQLDAAMLDAH
FT                   PHIDAVAAACRPLTADAAVWARLTATVTGIEARMPTEFRMERNDRTILDGSTQPLPDGA
FT                   TLVTLRDVTDSVNVERALVERNDALVAADHLKSTFVSHVSYELRSPLTTIIGFAQLLDD
FT                   TGIGPLNVKQRAYVNHITESSAALLAIINDILDLATIDAGSMALELTEVDVRAAMDAAA
FT                   EGVRDRLAEGGIRLSIELQNAAGSFRADAKRVRQILYNLLSNAVGFAPEGSTVTLSAER
FT                   REDGVIFRVRDMGPGVPPEIGARAFDRFESHTAGSRHRGVGLGLSIVRSLVALHGGTVS
FT                   LAPAQGGGTLVTCIFPLEAGASRDAAE"
     MAHPAGMGGE RNQGGRVPQV RPGRRLLRPL FTGLAFAAPI APASAAPASD VFAVLAVQDP        60
     SVLIGLALVV GLIVFATTTA IVHLRYRRQS LRREMAAFGE ISRLEAQIDE ARALLMAEPQ       120
     IVVVWRDPAA DPEIIGNTPA FTGVAAPARI LAFGSWLTPA SAREIEAAVD RLRGRGTPLA       180
     ATLATQDGRF VEADGRPVGA AVVLRLRDIT GVRLDQAQLE AAYRALDAES SALRTLLDAL       240
     PAPAWVDGED GRLRWSNAAY AHAVEARDAS DAASRGLMLL DQQSRTQAEK AHAASLPFKA       300
     RLPVVVAGTR RVLDVLEVPA GGGAAGIALD ATEAEVVRAE LAQVVGAHRR TLDQLATAVA       360
     IFGADQRLVF HNAAYARLFD LDAAFLDDRP TDGAVLDRLR AARRLPEQAD FRLWREELHA       420
     AYRAIEPREH WWHLPGGRTL RVVTAPNPEG GITYLFDEVT ERLALESRFN SLTRIQSETL       480
     DALAEAVAVF GSDGRLGLVN SAFRRLWQLD AAMLDAHPHI DAVAAACRPL TADAAVWARL       540
     TATVTGIEAR MPTEFRMERN DRTILDGSTQ PLPDGATLVT LRDVTDSVNV ERALVERNDA       600
     LVAADHLKST FVSHVSYELR SPLTTIIGFA QLLDDTGIGP LNVKQRAYVN HITESSAALL       660
     AIINDILDLA TIDAGSMALE LTEVDVRAAM DAAAEGVRDR LAEGGIRLSI ELQNAAGSFR       720
     ADAKRVRQIL YNLLSNAVGF APEGSTVTLS AERREDGVIF RVRDMGPGVP PEIGARAFDR       780
     FESHTAGSRH RGVGLGLSIV RSLVALHGGT VSLAPAQGGG TLVTCIFPLE AGASRDAAE        839
//

If you have problems or comments...

PBIL Back to PBIL home page