(data stored in ACNUC1104 zone)

EMBL: CP002026.PE298

CP002026.PE298       Location/Qualifiers
FT   CDS             291017..292846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0301"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079;
FT                   aminoglycoside phosphotransferase; KEGG: xau:Xaut_3297
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87635"
FT                   /db_xref="GOA:D7A219"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A219"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH87635.1"
FT                   /translation="MIDGRTTGAVPTMPVAHWDVVLPDEVATGRLAMDLAAMLRPGDLV
FT                   ALDGDLGAGKTTLARALIRELAGDPELEVPSPTFTLMQTYDLPRHRVVHADLYRLSDAS
FT                   ELDELGWQEQTDGAVTLVEWPERAEGAVLKTDRLEVHISMPQDRPETARRVRLLGYGRL
FT                   AGALYRMRAIRSLIDSTGFGPARRRHLQGDASTRSYERLVGAKRNAILMNAPRRPDGPP
FT                   VRAGRSYSAVAHLAEDVKPFVAMARGLRARGFSAPAIYGGDLDAGLLVIEDLGEEGVLA
FT                   GTPPAPVPERYEASVDVLAALHALDLPATLAVASGIDHQIPPYDLEALTIEAELLLDWY
FT                   LPHCGVALPADARQSFRQLWAAALAPSLAQKPVWTLRDFHSPNLMWLPQREGIAKVGLL
FT                   DFQDAVMGPPAYDVVSLAQDARVDVPEALELHLLGRYVKARREADADFDMRGFAASYAV
FT                   MGAQRATKILGIFARLNHRDRKPGYLRHMPRIWNYLQRCLAFTDLEALAGWYKDHVPPP
FT                   RLHGRPEGAVGMPAPAPVPAAPLAPPRPAEAAPKAPPAAPPAEAPPPTEAAAVTETPSA
FT                   PATVAEAPAAETPPDAVPSEAASTQTPNDPATT"
     MIDGRTTGAV PTMPVAHWDV VLPDEVATGR LAMDLAAMLR PGDLVALDGD LGAGKTTLAR        60
     ALIRELAGDP ELEVPSPTFT LMQTYDLPRH RVVHADLYRL SDASELDELG WQEQTDGAVT       120
     LVEWPERAEG AVLKTDRLEV HISMPQDRPE TARRVRLLGY GRLAGALYRM RAIRSLIDST       180
     GFGPARRRHL QGDASTRSYE RLVGAKRNAI LMNAPRRPDG PPVRAGRSYS AVAHLAEDVK       240
     PFVAMARGLR ARGFSAPAIY GGDLDAGLLV IEDLGEEGVL AGTPPAPVPE RYEASVDVLA       300
     ALHALDLPAT LAVASGIDHQ IPPYDLEALT IEAELLLDWY LPHCGVALPA DARQSFRQLW       360
     AAALAPSLAQ KPVWTLRDFH SPNLMWLPQR EGIAKVGLLD FQDAVMGPPA YDVVSLAQDA       420
     RVDVPEALEL HLLGRYVKAR READADFDMR GFAASYAVMG AQRATKILGI FARLNHRDRK       480
     PGYLRHMPRI WNYLQRCLAF TDLEALAGWY KDHVPPPRLH GRPEGAVGMP APAPVPAAPL       540
     APPRPAEAAP KAPPAAPPAE APPPTEAAAV TETPSAPATV AEAPAAETPP DAVPSEAAST       600
     QTPNDPATT                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page