(data stored in ACNUC1104 zone)

EMBL: CP002026.PE303

CP002026.PE303       Location/Qualifiers
FT   CDS             300627..301133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0306"
FT                   /product="Domain of unknown function DUF1993"
FT                   /note="PFAM: Domain of unknown function DUF1993; KEGG:
FT                   vap:Vapar_2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87640"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7A224"
FT                   /inference="protein motif:PFAM:PF09351"
FT                   /protein_id="ADH87640.1"
FT                   /translation="MPLSIYDASIPVFERALRNLDAILTKAEEHAAANGIDLSELAAAR
FT                   LAPDMFPLTGQIQSASDSAKFAAARLTGTTGPSFADTETTFEELHARIAKTLDYLASVD
FT                   RAGFEGAETREIVQKSRRGERHFVGQAYLLTFALPNFFFHVTTAYDILRHKGVPVGKSD
FT                   YLGAF"
     MPLSIYDASI PVFERALRNL DAILTKAEEH AAANGIDLSE LAAARLAPDM FPLTGQIQSA        60
     SDSAKFAAAR LTGTTGPSFA DTETTFEELH ARIAKTLDYL ASVDRAGFEG AETREIVQKS       120
     RRGERHFVGQ AYLLTFALPN FFFHVTTAYD ILRHKGVPVG KSDYLGAF                    168
//

If you have problems or comments...

PBIL Back to PBIL home page