(data stored in ACNUC1104 zone)

EMBL: CP002026.PE304

CP002026.PE304       Location/Qualifiers
FT   CDS             301435..303363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0307"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: azc:AZC_0150 hypothetical protein; PFAM:
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87641"
FT                   /db_xref="GOA:D7A225"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A225"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADH87641.1"
FT                   /translation="MSGARKRGIVFGLAAAFWGLGLAPAPAQTPAAPDDSALVARGEYL
FT                   ARAADCMPCHTGDKAKPFAGGLGLNTPFGTLYSVNITSDVATGIGSWSFDDFRRALHDG
FT                   IRKDGAYLYPAMPFDAYTGITEDDLKALWAYVRRIPAVNAPNPENGLSFPFNIRLGMLA
FT                   WRELFFQPAFFKPTPGKSDEWNRGAYLVEALGHCSDCHSPRNIMGAIKGKEAFTGAEVD
FT                   GFYAPDIASGALGKTWRKDMLIQFLKTGSAPQKTVVFGPMAEVVHDSLSHLTDADLAAM
FT                   ATYLLESPPPLDAPAPQKASPLPADVYARASKLFIDNCAVCHQQQGTGLLGAIPSLAGN
FT                   PAVTAAEPYNVIAATLHGLPSDGHYGTMPSFAGRLSDQQIADVVNYVRTAWGNQGTPNA
FT                   TPRMVAAWRETVKVPDYGTQAASAFDCAQVGGAPGAPGPDPKAVAALTAAIAGGNREVS
FT                   SLVESYEAAAPNASPAQVVDALMAAYCPVVAAGAGEDYQKYARLKGFTLQAAADVSFRG
FT                   TPDSLPDVPVVTAVVAGKSLVARQPESLAGPLACPAAGKIPADLVTAAAGLIGKPQLPV
FT                   PGGAGGGYARELVTKNPKARPADIANALILSYCGLVAADKGIEPATQHAYVEDFGQQVI
FT                   QTLQVQP"
     MSGARKRGIV FGLAAAFWGL GLAPAPAQTP AAPDDSALVA RGEYLARAAD CMPCHTGDKA        60
     KPFAGGLGLN TPFGTLYSVN ITSDVATGIG SWSFDDFRRA LHDGIRKDGA YLYPAMPFDA       120
     YTGITEDDLK ALWAYVRRIP AVNAPNPENG LSFPFNIRLG MLAWRELFFQ PAFFKPTPGK       180
     SDEWNRGAYL VEALGHCSDC HSPRNIMGAI KGKEAFTGAE VDGFYAPDIA SGALGKTWRK       240
     DMLIQFLKTG SAPQKTVVFG PMAEVVHDSL SHLTDADLAA MATYLLESPP PLDAPAPQKA       300
     SPLPADVYAR ASKLFIDNCA VCHQQQGTGL LGAIPSLAGN PAVTAAEPYN VIAATLHGLP       360
     SDGHYGTMPS FAGRLSDQQI ADVVNYVRTA WGNQGTPNAT PRMVAAWRET VKVPDYGTQA       420
     ASAFDCAQVG GAPGAPGPDP KAVAALTAAI AGGNREVSSL VESYEAAAPN ASPAQVVDAL       480
     MAAYCPVVAA GAGEDYQKYA RLKGFTLQAA ADVSFRGTPD SLPDVPVVTA VVAGKSLVAR       540
     QPESLAGPLA CPAAGKIPAD LVTAAAGLIG KPQLPVPGGA GGGYARELVT KNPKARPADI       600
     ANALILSYCG LVAADKGIEP ATQHAYVEDF GQQVIQTLQV QP                          642
//

If you have problems or comments...

PBIL Back to PBIL home page