(data stored in ACNUC1104 zone)

EMBL: CP002026.PE305

CP002026.PE305       Location/Qualifiers
FT   CDS             303590..304453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0308"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: oan:Oant_2567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87642"
FT                   /db_xref="GOA:D7A226"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7A226"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH87642.1"
FT                   /translation="MSLRSLGSMLLLAVMWGLSIPVTKMGLETLPPLTLTALRFAVAVP
FT                   LLFALLAGRWRLPWRAVPKVAALGFLAIGIGQVTQTLGVVGTSASVGTVITATIPLFIV
FT                   VIAALRLRQPVTLLQTAGLIAAFAGIALVAFGDRDPAALAQTTASGAILMLLSAAAIAF
FT                   YYVWSVEVADAYGTVTVVAWSTLCGFISLAPWAAWEASNTPFVIGVTAIGAAIYLGVVV
FT                   TVAGLFLWLNMLRTVPARVAASVQFLQPVVGVMASAALFGDHLGLAFFVGVALVLTGLA
FT                   TTLANR"
     MSLRSLGSML LLAVMWGLSI PVTKMGLETL PPLTLTALRF AVAVPLLFAL LAGRWRLPWR        60
     AVPKVAALGF LAIGIGQVTQ TLGVVGTSAS VGTVITATIP LFIVVIAALR LRQPVTLLQT       120
     AGLIAAFAGI ALVAFGDRDP AALAQTTASG AILMLLSAAA IAFYYVWSVE VADAYGTVTV       180
     VAWSTLCGFI SLAPWAAWEA SNTPFVIGVT AIGAAIYLGV VVTVAGLFLW LNMLRTVPAR       240
     VAASVQFLQP VVGVMASAAL FGDHLGLAFF VGVALVLTGL ATTLANR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page