(data stored in ACNUC1104 zone)

EMBL: CP002026.PE308

CP002026.PE308       Location/Qualifiers
FT   CDS             307140..308102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0311"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="PFAM: SH3 type 3 domain protein; KEGG: bxe:Bxe_A1493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87645"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7A229"
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /protein_id="ADH87645.1"
FT                   /translation="MRILVAGAMLLMALGGSAFAQGRGFVTTDVNLRAGPSVEYPVVLV
FT                   LAEGSPLDIFGCLEDYSWCDVAVDDYRGWVAAQYVESVYQGRRVEFYDYAPVIGVPIIG
FT                   FTFGDYWGRYYQGRPWYSTYDRWGPPRRPPVWGPPGWAPPPKPGWGKPGWGGPGWGGPP
FT                   PPKPGWGGKPPNGGWNGNPPHGGWNGNPPHGGWGGKPGNNPGWNGNPGWNGNPGWNGGK
FT                   PPQGGKPPQGGKPPQQGGPPPQGKPPQWQRPPQQGQKPPQSPPQQQWLQRPPQGPVPYD
FT                   TSRWRNNQSAPPSQQPQRPGYGGRPNCVPNTPGCPAPQR"
     MRILVAGAML LMALGGSAFA QGRGFVTTDV NLRAGPSVEY PVVLVLAEGS PLDIFGCLED        60
     YSWCDVAVDD YRGWVAAQYV ESVYQGRRVE FYDYAPVIGV PIIGFTFGDY WGRYYQGRPW       120
     YSTYDRWGPP RRPPVWGPPG WAPPPKPGWG KPGWGGPGWG GPPPPKPGWG GKPPNGGWNG       180
     NPPHGGWNGN PPHGGWGGKP GNNPGWNGNP GWNGNPGWNG GKPPQGGKPP QGGKPPQQGG       240
     PPPQGKPPQW QRPPQQGQKP PQSPPQQQWL QRPPQGPVPY DTSRWRNNQS APPSQQPQRP       300
     GYGGRPNCVP NTPGCPAPQR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page