(data stored in ACNUC1104 zone)

EMBL: CP002026.PE309

CP002026.PE309       Location/Qualifiers
FT   CDS             308305..308505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0312"
FT                   /product="ribosomal protein L35"
FT                   /note="KEGG: mno:Mnod_5554 ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35; PFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87646"
FT                   /db_xref="GOA:D7A230"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D7A230"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ADH87646.1"
FT                   /translation="MPKMKTKSGAKKRFKLSGTGKVVMAQAGKRHGMIKRTNKQIRDQR
FT                   GTTVMSERDAFNVRKFYLPNG"
     MPKMKTKSGA KKRFKLSGTG KVVMAQAGKR HGMIKRTNKQ IRDQRGTTVM SERDAFNVRK        60
     FYLPNG                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page