(data stored in ACNUC1104 zone)

EMBL: CP002026.PE31

CP002026.PE31        Location/Qualifiers
FT   CDS             25243..26691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_0059 agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87368"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87368.1"
FT                   /translation="MPTPSTVIALGARGTVHEVTEDANFYYFRSDSMGCATLPFKMKKT
FT                   AFTDLAKIVDGHTGTRCYVGYGQSWRTMSGGAIKSWVAGYSAEPESALTFHQTNSAGAR
FT                   SVLGPTVGVYWPGSTFVDDICGMSLNEPITLDRVAAVARARWRRKRVIRQFSDFHFTFG
FT                   YPSSGWDWGGSGGAGLNENSPSWANGIAALNRLRTILTGYGLSVALAPLSWTQGGDPNK
FT                   NLAGNLDDLAQLRHHWGEDAAGGAAQPLFIGIAPGGSSTTEMPVGAKAQIQYCRDNVGS
FT                   GIHLTFPWYMLRLTSTGPGDDGSIHFDSAGMVRYGAVEGYVQAIVEAGVVWTPFWLTRD
FT                   VDPVRVDGQEVVVTFDAPPGGDFDRKAPRVITRDDEPDLPGLAESHGFRVKRAGTFLTL
FT                   GTPTYGLNASGKPEARLPVVETLVSGDALEVSYCAYGTGSVPFGHSGVWGNVILRGPRC
FT                   PVRKDVPDPFVDMPLVPFIAASTA"
     MPTPSTVIAL GARGTVHEVT EDANFYYFRS DSMGCATLPF KMKKTAFTDL AKIVDGHTGT        60
     RCYVGYGQSW RTMSGGAIKS WVAGYSAEPE SALTFHQTNS AGARSVLGPT VGVYWPGSTF       120
     VDDICGMSLN EPITLDRVAA VARARWRRKR VIRQFSDFHF TFGYPSSGWD WGGSGGAGLN       180
     ENSPSWANGI AALNRLRTIL TGYGLSVALA PLSWTQGGDP NKNLAGNLDD LAQLRHHWGE       240
     DAAGGAAQPL FIGIAPGGSS TTEMPVGAKA QIQYCRDNVG SGIHLTFPWY MLRLTSTGPG       300
     DDGSIHFDSA GMVRYGAVEG YVQAIVEAGV VWTPFWLTRD VDPVRVDGQE VVVTFDAPPG       360
     GDFDRKAPRV ITRDDEPDLP GLAESHGFRV KRAGTFLTLG TPTYGLNASG KPEARLPVVE       420
     TLVSGDALEV SYCAYGTGSV PFGHSGVWGN VILRGPRCPV RKDVPDPFVD MPLVPFIAAS       480
     TA                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page