(data stored in ACNUC1104 zone)

EMBL: CP002026.PE312

CP002026.PE312       Location/Qualifiers
FT   CDS             310282..312687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0315"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: azc:AZC_4450 phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87649"
FT                   /db_xref="GOA:D7A233"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D7A233"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ADH87649.1"
FT                   /translation="MKFTLSWLREHLSGDYSLDDVTGTLNRIGFEVEGVEDKAAKLKGF
FT                   SIAYVVSAVQHPNADKLRVCMVDTGQGEPVQVVCGAPNARTGMKSVFSPPGTYIPGKDI
FT                   TLGIGTIRGVESRGMLCSAAELELSEDHDGIIDLPADAPVGATYVDWAGLGDPVVEIAV
FT                   TPNRADGLGIHGIARDLAAAGVGTLIEKPIEAVKGAYPCPVSVIIAEGAPCPAFALRLV
FT                   RGVKNGPSPDWLQAKLRAIGLRPINTLVDITNFLTFDQNRPLHVFDAAKVHGNLVVRRA
FT                   KEGESLPALDGKTYALDESMCVIADDRAVESLAGVMGGEESGCDETTVDVLVESALWEP
FT                   INIAQTGRKLGLNSDARFRFERGIDPAFTLPGLEMATKLILDLCGGEASEVVLAGAIPD
FT                   TTRVIEFPLSLTEKLTGLVASDSEQVETLGKLGFKVEGTSGTARVTPPSWRGDIEGKAD
FT                   LVEEVVRIAGLDRVPSIPFPRDETARKPVLTTLQLRTRKAKRALAARGLVEAVTWSFVA
FT                   KEQAELFGGGAPELALANPIASDLSDMRPSLLPGLIGSAQANADRGHGDSALFEVGQVF
FT                   KGDRPQDQFIAATGIRRATARPMGAGRHWSAKAGAVDAFDAKADALAVLAAAGAPVANL
FT                   QISTDAPAWFHPGRSGTFRLGPNVIGHFGELHPSVLEALDADGPLVGFEVLIDRIPEPK
FT                   AKATRVKPLLELAAFQPVERDFAFVVPRSVAAGDMVKAAAGVDRKLITAVNVFDLYEGA
FT                   GIDEDKKSVALSVTLQPREKTLTDAEIEAVAGKIVAEVAKKTGAMLRG"
     MKFTLSWLRE HLSGDYSLDD VTGTLNRIGF EVEGVEDKAA KLKGFSIAYV VSAVQHPNAD        60
     KLRVCMVDTG QGEPVQVVCG APNARTGMKS VFSPPGTYIP GKDITLGIGT IRGVESRGML       120
     CSAAELELSE DHDGIIDLPA DAPVGATYVD WAGLGDPVVE IAVTPNRADG LGIHGIARDL       180
     AAAGVGTLIE KPIEAVKGAY PCPVSVIIAE GAPCPAFALR LVRGVKNGPS PDWLQAKLRA       240
     IGLRPINTLV DITNFLTFDQ NRPLHVFDAA KVHGNLVVRR AKEGESLPAL DGKTYALDES       300
     MCVIADDRAV ESLAGVMGGE ESGCDETTVD VLVESALWEP INIAQTGRKL GLNSDARFRF       360
     ERGIDPAFTL PGLEMATKLI LDLCGGEASE VVLAGAIPDT TRVIEFPLSL TEKLTGLVAS       420
     DSEQVETLGK LGFKVEGTSG TARVTPPSWR GDIEGKADLV EEVVRIAGLD RVPSIPFPRD       480
     ETARKPVLTT LQLRTRKAKR ALAARGLVEA VTWSFVAKEQ AELFGGGAPE LALANPIASD       540
     LSDMRPSLLP GLIGSAQANA DRGHGDSALF EVGQVFKGDR PQDQFIAATG IRRATARPMG       600
     AGRHWSAKAG AVDAFDAKAD ALAVLAAAGA PVANLQISTD APAWFHPGRS GTFRLGPNVI       660
     GHFGELHPSV LEALDADGPL VGFEVLIDRI PEPKAKATRV KPLLELAAFQ PVERDFAFVV       720
     PRSVAAGDMV KAAAGVDRKL ITAVNVFDLY EGAGIDEDKK SVALSVTLQP REKTLTDAEI       780
     EAVAGKIVAE VAKKTGAMLR G                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page