(data stored in ACNUC1104 zone)

EMBL: CP002026.PE316

CP002026.PE316       Location/Qualifiers
FT   CDS             316018..316680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0319"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   xau:Xaut_1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87653"
FT                   /db_xref="GOA:D7A237"
FT                   /db_xref="UniProtKB/TrEMBL:D7A237"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ADH87653.1"
FT                   /translation="MLRDAFAAFAETFSPDYRRVLLRSVGFAVGLLVALGIGAHYALTY
FT                   FVALDLRWAEITLDIVAAFGIFIAAIFLVPPVTSLIAGLFLDDVAAQVERGFPGEPEGQ
FT                   PLPIGRSLFLTVKFFGVMLAVNLVALLLLLVPGVNLVVFYVANGYLLGREYFQLAAMRY
FT                   RDEDEVALLRRHHAGAIFLAGLIIAAVVSVPILNLVTPVFATIFMVRLHKRLSRREY"
     MLRDAFAAFA ETFSPDYRRV LLRSVGFAVG LLVALGIGAH YALTYFVALD LRWAEITLDI        60
     VAAFGIFIAA IFLVPPVTSL IAGLFLDDVA AQVERGFPGE PEGQPLPIGR SLFLTVKFFG       120
     VMLAVNLVAL LLLLVPGVNL VVFYVANGYL LGREYFQLAA MRYRDEDEVA LLRRHHAGAI       180
     FLAGLIIAAV VSVPILNLVT PVFATIFMVR LHKRLSRREY                             220
//

If you have problems or comments...

PBIL Back to PBIL home page