(data stored in ACNUC1104 zone)

EMBL: CP002026.PE317

CP002026.PE317       Location/Qualifiers
FT   CDS             complement(316677..317528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0320"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART: HhH-GPD family protein; TIGRFAM: endonuclease
FT                   III; KEGG: azc:AZC_3684 endonuclease III/Nth precursor;
FT                   PFAM: HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87654"
FT                   /db_xref="GOA:D7A238"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7A238"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADH87654.1"
FT                   /translation="MADGDRDSGSGPARERAGTRKPAAKPASGKAAAKKIASKAKAVLE
FT                   EQAATRPGRRRAVANAAAAAIGGAFKPWTKKEVETAFSRFEEANPHPEGELNYHDPFTL
FT                   LVAVVLSAQATDAGVNKATKTLFEEAPTPARMVALGEEGVARHIRTLGLYRGKAKNVVE
FT                   LSRLLIAEHDGKVPPDRAALEALPGVGRKTANVVLNIAFHMPTIAVDTHLFRVANRTGL
FT                   APGKTPLEVELGLERVIPDRFKLHAHHWLILHGRYICKALKPECPRCLIADLCRWPEKT
FT                   PA"
     MADGDRDSGS GPARERAGTR KPAAKPASGK AAAKKIASKA KAVLEEQAAT RPGRRRAVAN        60
     AAAAAIGGAF KPWTKKEVET AFSRFEEANP HPEGELNYHD PFTLLVAVVL SAQATDAGVN       120
     KATKTLFEEA PTPARMVALG EEGVARHIRT LGLYRGKAKN VVELSRLLIA EHDGKVPPDR       180
     AALEALPGVG RKTANVVLNI AFHMPTIAVD THLFRVANRT GLAPGKTPLE VELGLERVIP       240
     DRFKLHAHHW LILHGRYICK ALKPECPRCL IADLCRWPEK TPA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page