(data stored in ACNUC1104 zone)

EMBL: CP002026.PE319

CP002026.PE319       Location/Qualifiers
FT   CDS             318210..319088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0322"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; helix-turn-helix- domain
FT                   containing protein AraC type; KEGG: xau:Xaut_2813
FT                   methylated-DNA--protein-cysteine methyltransferase; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87656"
FT                   /db_xref="GOA:D7A240"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7A240"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADH87656.1"
FT                   /translation="MLAPNLDAAHPLEIAAHDYEIVRRAVEYVNLRFRDQPEVEEIARA
FT                   AGVNPRALTDLFRRWCGLTPKDFLQAVTIDAARRVLTESDNVLDAAYELGLSGPGRLHD
FT                   LFIVHESMSPGEWKTGGAGLVVRYGFHASQFGMALAMVTPRGLCGLAFADEGEEDKALA
FT                   DMRRRWPNALYIEDPIATAPYAARIFDSQKWSLDDPLRIVFIGTDFEVRVWETLMRIPL
FT                   GKATTYSNIASCVERPSAARAVGAAIGKNPMSFVVPCHRVLGKNGDLTGYHWGLTRKRA
FT                   ILGWEAGQLCK"
     MLAPNLDAAH PLEIAAHDYE IVRRAVEYVN LRFRDQPEVE EIARAAGVNP RALTDLFRRW        60
     CGLTPKDFLQ AVTIDAARRV LTESDNVLDA AYELGLSGPG RLHDLFIVHE SMSPGEWKTG       120
     GAGLVVRYGF HASQFGMALA MVTPRGLCGL AFADEGEEDK ALADMRRRWP NALYIEDPIA       180
     TAPYAARIFD SQKWSLDDPL RIVFIGTDFE VRVWETLMRI PLGKATTYSN IASCVERPSA       240
     ARAVGAAIGK NPMSFVVPCH RVLGKNGDLT GYHWGLTRKR AILGWEAGQL CK               292
//

If you have problems or comments...

PBIL Back to PBIL home page