(data stored in ACNUC1104 zone)

EMBL: CP002026.PE320

CP002026.PE320       Location/Qualifiers
FT   CDS             complement(319110..319550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0323"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   mrd:Mrad2831_5841 transmembrane pair domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87657"
FT                   /db_xref="GOA:D7A241"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:D7A241"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADH87657.1"
FT                   /translation="MRTPADRIRHVVIFEIIALSIITPLGAWVFGLPMTEMGVVGAGAA
FT                   LIAASWNYLFNLGFDHALARLRGSVRKTLGLRVVHALLFEAGLLAVLVPFIAWYLRIGL
FT                   VEAFLMDVALAGFFLIYAFLFNWAYDVIFPVRETRRRPVPAE"
     MRTPADRIRH VVIFEIIALS IITPLGAWVF GLPMTEMGVV GAGAALIAAS WNYLFNLGFD        60
     HALARLRGSV RKTLGLRVVH ALLFEAGLLA VLVPFIAWYL RIGLVEAFLM DVALAGFFLI       120
     YAFLFNWAYD VIFPVRETRR RPVPAE                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page