(data stored in ACNUC1104 zone)

EMBL: CP002026.PE322

CP002026.PE322       Location/Qualifiers
FT   CDS             complement(320311..321126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0325"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="TIGRFAM: dihydrodipicolinate reductase; KEGG:
FT                   mpo:Mpop_2435 dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87659"
FT                   /db_xref="GOA:D7A243"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A243"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADH87659.1"
FT                   /translation="MTQMRLVVVGASGRMGRVLIRAVDEAPDLLLVGAIDQPGSEFIGR
FT                   DAGELAGLPPLGVKISDDALTHFAAADGVIDFTVPQATVGYAALAAQARIVHVIGTTGF
FT                   SPEDEEKIAAASRHAAIVKSGNMSLGVNLLAALVRRVARTLDEGFDIEVLEMHHNRKID
FT                   APSGTALLLGQAAAQGRGVTLEENGVFTRHGHTGARKAGDIGFATLRGGSVVGEHNVIF
FT                   AGQAERIELAHKAEDRGIFARGALAAARWARGRKPGLYSMADVLGLADF"
     MTQMRLVVVG ASGRMGRVLI RAVDEAPDLL LVGAIDQPGS EFIGRDAGEL AGLPPLGVKI        60
     SDDALTHFAA ADGVIDFTVP QATVGYAALA AQARIVHVIG TTGFSPEDEE KIAAASRHAA       120
     IVKSGNMSLG VNLLAALVRR VARTLDEGFD IEVLEMHHNR KIDAPSGTAL LLGQAAAQGR       180
     GVTLEENGVF TRHGHTGARK AGDIGFATLR GGSVVGEHNV IFAGQAERIE LAHKAEDRGI       240
     FARGALAAAR WARGRKPGLY SMADVLGLAD F                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page