(data stored in ACNUC1104 zone)

EMBL: CP002026.PE332

CP002026.PE332       Location/Qualifiers
FT   CDS             complement(332205..333380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0336"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; KEGG: xau:Xaut_2941
FT                   spermidine/putrescine ABC transporter ATPase subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87669"
FT                   /db_xref="GOA:D7A253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A253"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADH87669.1"
FT                   /translation="MSNGVAEKTQKTIGGIRRKFAPWNDPQAVPLIRYQNVTKRFGEFT
FT                   AVDNLSLDIYEREFFALLGPSGCGKTTLMRMLAGFEDPTEGKITLAGQNLVGTPPYKRQ
FT                   TNMMFQSYALFPHMSVWDNIAFGLRQDRMEKGAVAARVEEMLKLVKLEKFAKRKPHQLS
FT                   GGQRQRVALARSLAKRPKVLLLDEPLGALDKKLREETQFELMDIQMELGMTFLIVTHDQ
FT                   EEAMTVADRIAVMNHGKLVQVDQPAVIYEQPNSRYVADFVGDVNILDAKVEALAPGAVT
FT                   LRSEAAPDMPIRVAQECAAKVGDSVAVALRPEKLRVELDPPADPSVNTLTGTIWDIGYL
FT                   GDLSIYHVELPNGMRVKAAKPNLTRMVERPITWEDKVYVSFTPDAGVVLTN"
     MSNGVAEKTQ KTIGGIRRKF APWNDPQAVP LIRYQNVTKR FGEFTAVDNL SLDIYEREFF        60
     ALLGPSGCGK TTLMRMLAGF EDPTEGKITL AGQNLVGTPP YKRQTNMMFQ SYALFPHMSV       120
     WDNIAFGLRQ DRMEKGAVAA RVEEMLKLVK LEKFAKRKPH QLSGGQRQRV ALARSLAKRP       180
     KVLLLDEPLG ALDKKLREET QFELMDIQME LGMTFLIVTH DQEEAMTVAD RIAVMNHGKL       240
     VQVDQPAVIY EQPNSRYVAD FVGDVNILDA KVEALAPGAV TLRSEAAPDM PIRVAQECAA       300
     KVGDSVAVAL RPEKLRVELD PPADPSVNTL TGTIWDIGYL GDLSIYHVEL PNGMRVKAAK       360
     PNLTRMVERP ITWEDKVYVS FTPDAGVVLT N                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page