(data stored in ACNUC1104 zone)

EMBL: CP002026.PE333

CP002026.PE333       Location/Qualifiers
FT   CDS             333574..334974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0337"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="KEGG: azc:AZC_4442 glutamine synthetase family
FT                   protein; PFAM: glutamine synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87670"
FT                   /db_xref="GOA:D7A254"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A254"
FT                   /inference="protein motif:PRIAM:6.3.1.11"
FT                   /protein_id="ADH87670.1"
FT                   /translation="MAKKKRPDKDVVEAPRGVTSLAEAKAWMAARGITEIECAVPDLAG
FT                   VGRGKIMPVSKFLSGPTMNLPLSVFFQTISGDYPPYDGLVDSVVVDSDLVMEPDFSTLA
FT                   VVPWAQDPTAQIIHDAYHRDGRPVDLAPRQVLKNVVELYSHKGWKAVVAPEIEFYLVEP
FT                   NTDADYPLKPPIGRSGRPEIGRQSYSIQAVNEFDALFEDMYDYSEAQGLEIDTLIHEDG
FT                   AAQMEINLLHGDPVVLADQVFLFKRTIREAALAHKIYATFMAKPIADEPGSAMHIHQSI
FT                   VDAETGKNIFSDKDGDPTPEFFSFIAGQQRYMPAVMSIMAPYVNSYRRLTRDSMAPINV
FT                   QWGYDNRTAGLRVPPSSPAARRVENRVPSSDANPYLVIAASLACGYLGLVEGLRPTDPL
FT                   EADAKFLDFELPRGLLEAVAALQYSEEIAGVLGPSFVKTYTAVKQQEFDTFMRVISPWE
FT                   REYLLLNV"
     MAKKKRPDKD VVEAPRGVTS LAEAKAWMAA RGITEIECAV PDLAGVGRGK IMPVSKFLSG        60
     PTMNLPLSVF FQTISGDYPP YDGLVDSVVV DSDLVMEPDF STLAVVPWAQ DPTAQIIHDA       120
     YHRDGRPVDL APRQVLKNVV ELYSHKGWKA VVAPEIEFYL VEPNTDADYP LKPPIGRSGR       180
     PEIGRQSYSI QAVNEFDALF EDMYDYSEAQ GLEIDTLIHE DGAAQMEINL LHGDPVVLAD       240
     QVFLFKRTIR EAALAHKIYA TFMAKPIADE PGSAMHIHQS IVDAETGKNI FSDKDGDPTP       300
     EFFSFIAGQQ RYMPAVMSIM APYVNSYRRL TRDSMAPINV QWGYDNRTAG LRVPPSSPAA       360
     RRVENRVPSS DANPYLVIAA SLACGYLGLV EGLRPTDPLE ADAKFLDFEL PRGLLEAVAA       420
     LQYSEEIAGV LGPSFVKTYT AVKQQEFDTF MRVISPWERE YLLLNV                      466
//

If you have problems or comments...

PBIL Back to PBIL home page