(data stored in ACNUC1104 zone)

EMBL: CP002026.PE336

CP002026.PE336       Location/Qualifiers
FT   CDS             337734..338156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0340"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: nwi:Nwi_1654
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87673"
FT                   /db_xref="GOA:D7A257"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A257"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH87673.1"
FT                   /translation="MSAPVPGDLVPFLRYADPHAAIAWLKKALGFSPILVVDDGHGGVA
FT                   HAELALGTSALMIGGVKDDVLRMRTPAEAGGVTQGIYVVVPDADALWTCTMEAGAEVVM
FT                   AIYDTPYGSREFTVRDPEGHLWSVGTYRAGSYKSDS"
     MSAPVPGDLV PFLRYADPHA AIAWLKKALG FSPILVVDDG HGGVAHAELA LGTSALMIGG        60
     VKDDVLRMRT PAEAGGVTQG IYVVVPDADA LWTCTMEAGA EVVMAIYDTP YGSREFTVRD       120
     PEGHLWSVGT YRAGSYKSDS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page