(data stored in ACNUC1104 zone)

EMBL: CP002026.PE338

CP002026.PE338       Location/Qualifiers
FT   CDS             complement(339818..340495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0342"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mdi:METDI0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87675"
FT                   /db_xref="GOA:D7A259"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A259"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87675.1"
FT                   /translation="MPIHRRSLLLGAPFLLAGCTTARRQEPTPVARSLAYAPSYETMYA
FT                   ALDGEPYPVPAVDLSQIDPRFLRREVAYATREEPGTIVVDVEARYAYLVMENGRALRYG
FT                   VGVGKEEGFNFRGAATIARKAEWPRWTPTPDMIRREPERYAKYAGGLPGGPGNPLGPRA
FT                   LYLYRDGRDTLYRLHGTIEPWTIGTMVSSGCIRLLNQDIIDLYRRVPAGSRAVVLSSAG
FT                   TAA"
     MPIHRRSLLL GAPFLLAGCT TARRQEPTPV ARSLAYAPSY ETMYAALDGE PYPVPAVDLS        60
     QIDPRFLRRE VAYATREEPG TIVVDVEARY AYLVMENGRA LRYGVGVGKE EGFNFRGAAT       120
     IARKAEWPRW TPTPDMIRRE PERYAKYAGG LPGGPGNPLG PRALYLYRDG RDTLYRLHGT       180
     IEPWTIGTMV SSGCIRLLNQ DIIDLYRRVP AGSRAVVLSS AGTAA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page