(data stored in ACNUC1104 zone)

EMBL: CP002026.PE339

CP002026.PE339       Location/Qualifiers
FT   CDS             340607..341521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bid:Bind_0309 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87676"
FT                   /db_xref="GOA:D7A260"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A260"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87676.1"
FT                   /translation="MDLAAALRAFVRTVERGSVTAAARDLAVTQPAVTKHLRNLERHVG
FT                   ARLLERSARLVRPTPQGAALYETSRSALASIDSALEGVRRDMGAIEGTLRIHAPACLGA
FT                   RRLHGIVMEFQAAHPGVNVDLILENRSVDLVYENLDLAVKYGRPEGQDLVIRRLGLVRR
FT                   VLVAAPSFLARCGPVDTLERLSEVDIVTTPAVVSPRDMLMLQRAGTPLGESIEVPVRPV
FT                   LRTNAAEVIEQTLLGGHAAGPVQVLFAARDLAAGRLVRLLPEYEVRPSEAFLAYPSVRF
FT                   MRPVVRAFTDFAVPALRATEGIT"
     MDLAAALRAF VRTVERGSVT AAARDLAVTQ PAVTKHLRNL ERHVGARLLE RSARLVRPTP        60
     QGAALYETSR SALASIDSAL EGVRRDMGAI EGTLRIHAPA CLGARRLHGI VMEFQAAHPG       120
     VNVDLILENR SVDLVYENLD LAVKYGRPEG QDLVIRRLGL VRRVLVAAPS FLARCGPVDT       180
     LERLSEVDIV TTPAVVSPRD MLMLQRAGTP LGESIEVPVR PVLRTNAAEV IEQTLLGGHA       240
     AGPVQVLFAA RDLAAGRLVR LLPEYEVRPS EAFLAYPSVR FMRPVVRAFT DFAVPALRAT       300
     EGIT                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page