(data stored in ACNUC1104 zone)

EMBL: CP002026.PE340

CP002026.PE340       Location/Qualifiers
FT   CDS             complement(341556..342680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0344"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   azc:AZC_2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87677"
FT                   /db_xref="GOA:D7A261"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D7A261"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADH87677.1"
FT                   /translation="MTTEEYRIGIEEEYFIVDGETKSALRRMPAPFMDQARGALGEAVS
FT                   GEMLQSQIEMMTRPHVSAADARRQLHGLRRSLGEVAAEFDLAFLAAGTHPTASWQTGKR
FT                   TPTQRYDGLMHDLQMVGERNMLCGMHVHVELPDADQRVDVMRRILPYLPIFVALSTSSP
FT                   FWESKRTGLMGYRLAAYDELPRTGLPELFESAKDYQDYVDALVAARAIRDSSYVWWTIR
FT                   PSQKHPTLELRAPDSCTRVEDSVAIAALYRALVRHLVRDPKLNAGIDAVDRAIAVENKW
FT                   RAQRYGIHGSFVDRRTREAVPVTQAVETLIDQLREDARALGGLDELEHLRTILGGGTSA
FT                   DIQIAVYQEAAHRTGNRNEALNAVKTWLAHASAQ"
     MTTEEYRIGI EEEYFIVDGE TKSALRRMPA PFMDQARGAL GEAVSGEMLQ SQIEMMTRPH        60
     VSAADARRQL HGLRRSLGEV AAEFDLAFLA AGTHPTASWQ TGKRTPTQRY DGLMHDLQMV       120
     GERNMLCGMH VHVELPDADQ RVDVMRRILP YLPIFVALST SSPFWESKRT GLMGYRLAAY       180
     DELPRTGLPE LFESAKDYQD YVDALVAARA IRDSSYVWWT IRPSQKHPTL ELRAPDSCTR       240
     VEDSVAIAAL YRALVRHLVR DPKLNAGIDA VDRAIAVENK WRAQRYGIHG SFVDRRTREA       300
     VPVTQAVETL IDQLREDARA LGGLDELEHL RTILGGGTSA DIQIAVYQEA AHRTGNRNEA       360
     LNAVKTWLAH ASAQ                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page